KEGG   Mycoplasma mobile: MMOB2390Help
Entry
MMOB2390          CDS       T00176                                 

Gene name
rpsS
Definition
(GenBank) 30S ribosomal protein s19
  KO
K02965  small subunit ribosomal protein S19
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2390 (rpsS)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    MMOB2390 (rpsS)
  Archaea
    MMOB2390 (rpsS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S19
Motif
Other DBs
NCBI-ProteinID: AAT27725
UniProt: Q6KI51
Position
301732..302007
Genome map
AA seq 91 aa AA seqDB search
MARSAKKGFYVEASLMKKVVNAIESKSKKPIKTWSRRSTIFPEFVGFTFQVHNGRQFIDV
YVTDDMVGHKLGEFSPTRTYTGHGSEKGKKK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatcagcaaaaaaaggattttatgtagaagcatcattaatgaaaaaagtagtt
aatgctatcgaatcaaaatcaaaaaaaccaatcaaaacatgatcaagacgttcaactatt
ttccctgaatttgtaggttttacatttcaagttcataatggaagacaatttattgatgtt
tatgtaacagatgatatggttgggcataaattaggagaattttcaccaacaagaacatac
acaggtcatggatcagaaaaaggtaagaaaaaataa

DBGET integrated database retrieval system