KEGG   Mycoplasma mobile: MMOB2510Help
Entry
MMOB2510          CDS       T00176                                 

Gene name
rplR
Definition
(GenBank) 50S ribosomal protein l18
  KO
K02881  
large subunit ribosomal protein L18
Organism
mmo  Mycoplasma mobile
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2510 (rplR)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB2510 (rplR)
  Bacteria
    MMOB2510 (rplR)
  Archaea
    MMOB2510 (rplR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
306379..306732
Genome map
AA seq 117 aa AA seqDB search
MAKLLSRNDARKAKHLRIRNKIRKTTNLPRVFVYKSLQNFYAQLFDDKLNKTIVSLGTSK
NKEYSGNIAAAKKLGHEMGALLKTKKIDKIVFDRSGYIYHGRVKAFAEAMREEGVKF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactattaagtcgtaatgatgcaagaaaagcaaaacatctacgtattcgtaat
aaaatacgtaaaacaacaaatttacctcgtgtttttgtttacaaatctttacaaaatttt
tatgcacaactttttgatgataaattaaataaaacaattgttagtttaggaacatctaaa
aacaaagaatatagcggtaatatagctgctgctaaaaaactaggacatgaaatgggagct
ttattaaaaactaaaaaaattgataaaattgtttttgatcgttctggatatatttatcac
ggaagagtaaaagcctttgctgaagcaatgcgtgaagaaggagttaaattttaa

DBGET integrated database retrieval system