KEGG   Mycoplasma mobile: MMOB2630Help
Entry
MMOB2630          CDS       T00176                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
mmo  Mycoplasma mobile
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MMOB2630 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    MMOB2630 (manB)
Enzymes [BR:mmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     MMOB2630 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(313249..314790)
Genome map
AA seq 513 aa AA seqDB search
MKELEFGTAGLRGILGKTKEHLNIFHVARVIEGFAKYLKSETFNWKNKIVIIGRDNRRKS
REFSRLAASILAFHKINVLISREIIATPIISYATKYHKALGAINITASHNPKEYNGIKLY
DKNGSQILPDVVDKIKSNFLNYEDYTKKQALNQFIFSIKNKYINYIPKQTLQSYEEKVLK
VGGSQKNLSNINLSFSPQHGTGAKIVKSIFKKLNVNAFFEEAQMKNDPDFTHTKSPNPED
KSSYENVIKLGLIHKSDAVLITDPDADRVGIGILRNNEYILLNGNETATLIFNYLIEINE
NKLQDKYLIYSFVSSSLPKKMAIENNIKWYEVATGFKYIGNLIEQIKNESKTSKLLFAFE
ESYGSLINDSLAYDKDAIQSCVILAKMISFYKKKSKTLLDVLEDIYKKYGYIKSESFSIN
LDEKNPLHLENIQSKFINLKFNEDFKIENFIKGKENIAPSNMIRISFQNLNWIALRPSGT
EAKIKFYLYVVDKDKILVEKNWNILKEKILSII
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagaatttggaactgcaggattaagaggaattttaggtaaaactaaagag
catttgaatattttccatgtagcaagagtaattgaaggttttgcaaaatatttgaaatca
gaaacttttaattgaaaaaataaaattgtaataatcggaagagataatcgaagaaaatca
agagagttttcaagattggcagcaagtattttagcttttcacaaaataaatgttttaatt
tctagagaaattattgcgaccccaattataagttatgcaacaaaatatcataaggcactt
ggtgctattaatattacagctagtcataatccaaaagaatataatggaattaaactttat
gataaaaatggctcacaaattttgccagatgttgttgataaaattaaatctaatttttta
aattatgaagattatacaaaaaagcaagcactaaatcaatttatttttagtattaaaaat
aaatacataaattatattccaaaacaaactttgcaatcatatgaagaaaaagttttaaaa
gttggtggcagccaaaaaaatctatcaaatatcaatttatcttttagtcctcaacatgga
acaggtgctaaaatagttaaatctatttttaaaaaattaaatgtaaatgctttttttgaa
gaagcacaaatgaaaaatgatccggattttactcatacaaaaagtccaaatccagaagat
aaatcttcttatgaaaatgtaattaaattaggtttaattcataaatcagatgctgttcta
attacagatccagatgcagatagggtaggaattggaattttaagaaataatgagtacatt
cttctaaacggaaacgaaacagcaactttaatttttaattatttgattgaaataaacgaa
aataaattgcaagataaatatttaatttattcctttgtttcttcaagtttacctaaaaaa
atggcaattgaaaacaatataaaatggtatgaagttgctacaggatttaaatatatagga
aatttaattgaacaaatcaaaaatgaatcaaaaacttcaaaattattatttgcctttgaa
gaatcatatggatctctgataaatgattcattagcatatgataaagatgcaattcaaagt
tgtgtaattcttgcaaaaatgattagtttttacaaaaagaaaagcaaaacccttttagat
gttttagaagatatttataaaaaatatggatatattaaaagtgaaagtttttcaattaat
ttggatgaaaaaaatcctttgcatttagaaaatattcagtcaaaatttataaatctaaaa
tttaatgaagactttaaaattgaaaactttattaaaggtaaagaaaatattgccccgagt
aatatgataagaattagttttcaaaatttaaattgaatcgctcttagaccttctggaaca
gaagcaaaaattaaattttatctttatgttgttgataaggataaaattttagtagaaaaa
aattgaaatattttaaaagaaaaaattctttctattatataa

DBGET integrated database retrieval system