KEGG   Mycoplasma mobile: MMOB2670Help
Entry
MMOB2670          CDS       T00176                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
318930..319655
Genome map
AA seq 241 aa AA seqDB search
MSGTNFWNNSRIVYNITLSGIFFALVLIFQSFFSLFSIFGFLNINFTIVFIIILALVSNF
KYALILLILRFIIGPAINSGYSEIGILGHFILLVSDVFFILFFTFAYYVLLTWKQIKLNK
YIILIISSITATIFNAFWMVFLNGLIFTPLFFALLGQNSANFLFYMQPQIWNSLKGLFFN
INTYWGGIFTLYTAFNLINFSLVSILFSSITIALFKAKIIENFDLKTFYFQKNFKKLKMN
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgggacaaacttttgaaataatagtagaattgtttataacattactcttagtggg
attttttttgctttagttctaatttttcaatcatttttttccttattttcaatttttggt
tttttaaatattaattttacaattgtatttattattattttagctttagtttcaaatttt
aaatacgctttaattttactcattttaagatttattattggccctgcaattaattcagga
tacagtgaaattggaattttagggcattttattttattggtaagtgatgttttttttata
ttgttttttacttttgcttattatgttttattaacttgaaaacaaattaaattaaacaaa
tatatcatcttaattatttcatctattacagcaacaattttcaatgcattttgaatggtt
tttttaaatggtctaatttttacacctttattttttgctttattaggacaaaattcggca
aatttcttattttacatgcaaccgcaaatttgaaatagcttaaaaggtctatttttcaat
ataaatacatactgaggtggaatttttactttatatacagcatttaacttaataaatttt
tcattagtatcaattttattttcctcaataacaatcgcactatttaaagcaaaaattatt
gaaaattttgacttgaaaactttttattttcaaaaaaattttaaaaaattaaaaatgaat
aagtaa

DBGET integrated database retrieval system