KEGG   Mycoplasma mobile: MMOB2700Help
Entry
MMOB2700          CDS       T00176                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmo  Mycoplasma mobile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MMOB2700 (ruvA)
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MMOB2700 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323305..323910
Genome map
AA seq 201 aa AA seqDB search
MNIYKIGKIVSFGKNYFLLESNYEGFLIYAAELEKFEKDVVTKVFIYKHENAYSKTLYGF
KTFKERLLFIDLLSINGIGPKTALMALESGYLEIMNLISNNDFETLSKLPFLGLKSAKQI
CFEFQSKYANLLEKENSGNLKFESKTKKITELSNTLKTLGFKTNQINYAISNINDKNDIE
EMLEESIQLIANEKEQISPNT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttataaaattggaaaaatagtaagttttggtaaaaactactttcttttagaa
tcgaactatgaaggatttttgatttatgctgctgaattagaaaaatttgaaaaagatgtt
gttacaaaagtttttatatacaaacatgagaacgcatattcaaaaactttgtatgggttc
aaaacatttaaagaaagacttctttttatcgatttgctttcgataaatggaattggacca
aaaactgcattgatggcattagaatcaggttacttagaaattatgaatttaatttctaat
aatgattttgaaactttatcaaaactaccttttttaggattgaaaagtgcaaagcaaatt
tgttttgaatttcaaagtaaatatgcaaatctattagaaaaagaaaattctggtaattta
aaatttgaatcaaaaacaaaaaaaattacagaattgtcaaatacattaaaaacattagga
tttaaaacaaatcaaataaattatgctatttcaaacattaatgataaaaatgatattgaa
gaaatgcttgaggaatcaatacaattaattgcaaatgaaaaagaacaaatttcccctaat
acatag

DBGET integrated database retrieval system