KEGG   Mycoplasma mobile: MMOB2860Help
Entry
MMOB2860          CDS       T00176                                 

Gene name
hsdM
Definition
(GenBank) type I restriction enzyme m protein
  KO
K03427  
type I restriction enzyme M protein [EC:2.1.1.72]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     MMOB2860 (hsdM)
Prokaryotic defense system [BR:mmo02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   MMOB2860 (hsdM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
350976..352550
Genome map
AA seq 524 aa AA seqDB search
MNNNKEIERNELHRTIWKIANDLRGSVDGWDFKQYVLGMLFYRYISENLANYINQGEWKA
TKKQDFRYENISDDKILSKKEEIKELVKEKGFFIRPSHLFVNIRKNASKNKDLNVALDKV
FKEIEASANGSSSEKDFKGLFDDINLNSSKLGSTVNERNEKLTKLINNIGEMKLGNFKDN
SIDAFGDAYEYLMSMYASNAGKSGGEYYTPQEVSELLTKITLIGKNEINKVYDPACGSGS
LLLNFAKILGKEKVRQGFFGQEINQTTYNLCRINMFLHDINYNKFNISQGDTLTNPLHNK
FEPFEAIVSNPPYSIKWAGKSNPLLINDPRFSPAGVLAPESKADLAFVMHSLSYLASNGT
AAIVTFPGVMYRKGAEEKIRKYLIDNNFIDAIIQLPENLFFGTSIATCVLVLKKNKKENS
TLFIDASKEFQKATNSNKLLSENISKILNTYEKRLDQEYFSKNVSNSKISEESYNLSVST
YIEQKFEKEIIDINILNKEIQKISNKGKFLRKEIEKIIKEIEQE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataataaagaaatagaaagaaatgaattacatagaacgatttgaaaaattgct
aatgatttaagaggaagtgttgatgggtgagattttaaacaatatgttttaggaatgcta
ttttatcgctatatttcagagaatttagctaattatattaatcaaggtgaatgaaaagca
actaaaaaacaagattttcgttatgaaaatattagtgatgataaaatattgtcaaaaaaa
gaagaaataaaagaacttgttaaagaaaagggtttttttattagacccagtcatttattt
gtaaatattagaaaaaatgcttctaaaaataaagatcttaatgttgcgcttgataaagta
tttaaagaaattgaagcatcagcaaatggttcatctagtgaaaaagactttaaaggatta
tttgatgatataaatcttaatagttctaaattaggctcaacagtaaatgaacgtaatgaa
aaattaactaaattaattaataatattggagaaatgaaattaggcaattttaaagataat
tcaattgatgcatttggagatgcatatgaatatcttatgagtatgtatgcttcaaatgct
ggtaaaagtggaggagaatattatacgccacaagaagtcagtgaattattaacaaaaatc
acccttataggaaaaaatgaaattaataaagtttatgatccagcttgtggttcaggttct
ttattattaaattttgctaaaattttaggaaaagaaaaagtaagacaaggtttttttggc
caagaaattaatcaaacaacttataatctttgtcgtattaatatgtttttacatgatatt
aattacaataaatttaatataagtcaaggagatactttaacaaatccacttcataataaa
tttgagccatttgaagctattgtttcaaatccgccatattcaattaaatgagcaggtaaa
agtaatcctttactaataaatgatccaagattttctccggccggagttttagctcctgaa
tctaaagcagatttagcttttgttatgcattctctttcatatttagcttcaaatggaaca
gctgcaattgtaacttttccaggagttatgtatcgtaaaggagcagaggaaaaaattaga
aaatatcttattgacaataattttattgatgccataattcaattgcctgaaaacttattt
tttggaactagtattgcgacatgtgttttggttctgaaaaaaaataaaaaagaaaatagt
actctttttattgatgcttcaaaagaatttcaaaaggctactaatagcaataaattgtta
tctgaaaatattagtaaaattttaaatacatatgaaaaaagattagatcaagaatatttt
tcaaaaaatgtttcaaatagtaaaatttctgaagaaagttataatttatcagtatctaca
tatattgagcaaaaattcgaaaaggaaataattgatattaacattcttaataaagaaata
caaaaaatttctaataagggtaaatttttgagaaaagaaattgaaaaaattattaaagaa
attgagcaagaataa

DBGET integrated database retrieval system