KEGG   Mycoplasma mobile: MMOB2870Help
Entry
MMOB2870          CDS       T00176                                 

Gene name
hsdS
Definition
(GenBank) type I restriction-modification enzyme s subunit
  KO
K01154  
type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     MMOB2870 (hsdS)
Prokaryotic defense system [BR:mmo02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   MMOB2870 (hsdS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
352550..353686
Genome map
AA seq 378 aa AA seqDB search
MNSLLNDLTKYIYSGDVKIVEIGSLLNYEQPSKYIVESTNYNKENQIPVLTAGKSFILGY
TNEKNNIYGASKNNPIIIFDDFTGSFKWVDFPFKIKSSAIKLLTVNSNNALLRYLYHIMT
SMNFFSKEHKRLYISIYSKIKIPLPSIEIQEKIVKFLDTFSELTAELTAELTAELTARKK
QYECYRDNLLSFNESTPYVSIGDVFEIINGKSILTKDYISKISGIYPVYSSQTLNKGIIG
YINKYEHNEESISWTRDGYVAGSVSYHFNEKFNISNRGLLKALNKNEVNTKFVFYLLEII
AKKHVNKRETIPHLTSSKMAKIKVPLPPIEVQNKIVNILDRFETLISDLTIGLPAEIEAR
KKQYEYYRDKLLDFKKVN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtttattaaatgatttaacaaaatatatatattcaggtgatgtgaaaattgtg
gaaataggaagtttacttaactatgaacaaccttcaaaatacatagtagaaagcacaaat
tataataaagaaaatcaaattcctgttttaacagcaggaaaatcttttatattaggttat
acaaatgaaaaaaacaacatatatggtgcgtccaaaaacaatcctattattatttttgat
gattttacaggctcattcaaatgagttgattttccttttaaaattaaatcatcagcaata
aaattattaacagtaaattcaaataatgctttattacgctatttatatcatattatgact
agtatgaattttttttccaaagaacataaaagactttatattagtatttattctaaaatt
aaaattccattaccatcaatagaaattcaagaaaaaattgtaaaatttttagacactttc
tcagaacttacagcagaacttacagcagaacttacagcagaacttacagcaagaaaaaaa
caatatgaatgttatcgtgataatttactttcattcaatgaaagtacaccatatgtttca
ataggtgatgttttcgaaataataaatggaaaaagtattttaacaaaagattatatatct
aaaattagtggtatttaccctgtatactcatcccaaacactcaataaaggaattattgga
tacatcaataaatatgagcacaatgaagaatcaatatcttgaacaagagacggctatgta
gcaggctctgtttcttatcattttaatgaaaaatttaacatatcaaatcgaggactttta
aaagcattaaataaaaatgaggtaaatacaaaatttgttttttaccttttagaaataata
gcaaaaaagcatgttaataaaagagaaacaattcctcatcttactagttcaaaaatggct
aaaatcaaagttcctctacctccaattgaagttcaaaataaaatagttaatattcttgat
cgttttgaaactttgattagtgatttaacaattggattacctgcagaaattgaagcaaga
aaaaaacaatatgaatattatcgggataaattattagattttaaaaaagtaaattaa

DBGET integrated database retrieval system