KEGG   Mycoplasma mobile: MMOB2970Help
Entry
MMOB2970          CDS       T00176                                 

Gene name
atpA
Definition
(GenBank) ATP synthase alpha chain
  KO
K02111  F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00190  Oxidative phosphorylation
mmo01100  Metabolic pathways
Module
mmo_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MMOB2970 (atpA)
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     MMOB2970 (atpA)
Photosynthesis proteins [BR:mmo00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MMOB2970 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C CobU AAA_14
Motif
Other DBs
NCBI-ProteinID: AAT27783
UniProt: Q6KHZ3
Position
complement(366229..367779)
Genome map
AA seq 516 aa AA seqDB search
MKPIIKSIQDNIIYVEGEFNYSQSQVFLINNKIHAYLLSASVNSANLLVESEIESLKIND
ELDLVENSGKISTYQKFYGKIIDIFGHIKYPIEANDIIDENEEKIGTGKIFNKALGMMFR
KSLNEPVQTGIASIDMLIPLGKGQRELIIGDRRTGKTSVALNTIISQKNTNTKAVYVAIG
QRKTNINFIYNTLEEFDVLKNTIILEASSENLYHQFFALYVGMTHAENIAKNGDDVIIVI
DDLSKHANIYREMALLINKPAGREAFPGDIFFTHSKVLERAGKFKNENWGTITALPIVET
IEGDITSLISSNIISITDGQIIMSSELAASGKFPAIDIELSVSRTGSKVQNKVLSKYSKK
ISKTFSLYKRNLKYSEIKYNFSSEIFDILSKGEVLENLFIQKGFSNYTLTTLIIISNLVE
WRILENIKDVSSVLDFINYFFDFDLTAKKIKEKIENEIEIDNELFKNFIINLINEFLFYS
SNQYYFENSDSVLKINKNFIKVYFDGNSKIKEVKND
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaattatcaaatcaatacaagacaacattatttatgtagaaggtgaatttaac
tatagtcaatcacaagtttttcttatcaataataaaattcatgcttatttattaagtgct
tcagtaaatagtgcaaatttacttgttgaatcagaaattgaatcattgaaaattaatgat
gaattagatttagttgaaaattctggaaaaataagtacatatcaaaagttttatggaaaa
ataatagatatttttgggcatataaaatatccaatcgaagcaaatgacataattgatgaa
aatgaagaaaaaataggaactggaaaaatttttaataaagctttagggatgatgtttcgt
aaaagtttaaatgagcctgtgcaaacagggattgcttcaattgatatgttaatcccttta
ggaaaagggcaaagagaattaattattggagatagaagaacaggtaaaacttctgttgcc
ttaaatacaattattagtcaaaaaaatacaaatactaaagctgtttatgttgcaatcgga
caaagaaaaactaatataaattttatctataatacacttgaagaatttgatgttttaaaa
aatacaattattttagaagcaagtagtgaaaatttatatcatcaattttttgctttatat
gttggtatgactcatgcagaaaatattgcaaaaaatggggatgatgtcattattgttatt
gatgatttatctaaacatgcaaatatttatcgtgaaatggctcttttaattaataaacca
gctggaagagaagcttttccaggagatattttttttacacattccaaagttcttgaaaga
gctggtaaattcaaaaatgaaaattgaggaacaataactgctttaccaattgttgaaaca
attgaaggagatatcacaagtttaattagtagtaatatcatttcaattacagacggacaa
attatcatgtcttcagaattagctgcttcaggaaaatttcctgcaattgatattgagctt
agtgtaagtaggactggatctaaagttcaaaataaagttctttcaaaatatagtaaaaaa
atttctaaaacattttctctttataaaagaaatttaaaatatagtgaaattaaatataat
ttttcatctgaaatttttgatattttatctaaaggagaagttttagaaaatctttttatt
caaaaaggttttagtaactatactttaacaactttaattattatttcaaatttagtcgaa
tgaagaattttagaaaatataaaagatgtttcaagtgttcttgattttattaattatttt
tttgattttgatttaacagctaaaaaaattaaggaaaaaattgaaaatgaaattgaaata
gataatgaattatttaaaaattttatcattaatttaattaatgaatttcttttttattca
agtaatcaatattattttgaaaattccgattctgttttaaaaattaacaaaaactttatc
aaagtgtattttgatggtaattcaaaaataaaagaggtaaaaaatgattaa

DBGET integrated database retrieval system