KEGG   Mycoplasma mobile: MMOB3040Help
Entry
MMOB3040          CDS       T00176                                 

Gene name
rplU
Definition
(GenBank) 50S ribosomal protein l21
  KO
K02888  
large subunit ribosomal protein L21
Organism
mmo  Mycoplasma mobile
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB3040 (rplU)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB3040 (rplU)
  Bacteria
    MMOB3040 (rplU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
374176..374475
Genome map
AA seq 99 aa AA seqDB search
MFAIIETGGKQILVKKDDFIFIEKIEGEAGQNVVFDKVLLVDDKIGTPFLKNATVTGIIE
KQGKQKKIVVYRHNAKSTHKRKLGHRQPYTRVKILEIKG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaattattgaaacaggtggaaagcaaattcttgtaaaaaaagatgatttcatt
tttattgaaaaaattgaaggtgaagcaggtcaaaatgtagtttttgataaagtactttta
gttgatgataaaattggaactccctttttaaagaatgctactgtaactggtattatagaa
aagcaaggtaaacaaaaaaagattgttgtttatcgtcataatgccaaatcaactcacaaa
agaaaattagggcaccgtcagccttatactagagtaaaaattttagaaattaaaggataa

DBGET integrated database retrieval system