KEGG   Mycoplasma mobile: MMOB3110Help
Entry
MMOB3110          CDS       T00176                                 

Definition
(GenBank) internal repeat-containing expressed protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT27797
UniProt: Q6KHX9
Position
complement(380253..382217)
Genome map
AA seq 654 aa AA seqDB search
MKIFKKNKKIKKISKKTTDELFVENSLILPVENENKTNEVNLYNSKSYAGPYRFDPFKNK
NIETNTLDLKVAATFFPSGKESISNINSFKKSNKNYEIETNLGNNFENKIESDLIFPGYL
ENFKRTNKTFREESKIQKNPINEYENNSFHDLNKKLDFSEYDFSKLKDFSNNKIEKEEYK
EIFSNSYSNTQENSLAVNKIETNNLNQKEYSLGDFSETIFIQNDASQQNQDVSNFPNLEK
TKDDLNFNTGSKNEIENSDFFQSSFNSNSDTFNQNKNVKEYSIPKPEYIPKKQVNTNNTQ
EQIVFQQEPVSPLNKAKPYEYAFNQQFEYIPKKQVNTNNTQEQIVFQQEPVSPLNKAKPY
EYAFNQQFEYIPKKQVNTNNTQEQIIFSQPQNNKRTVGYEYAFGQQFNYIPKKQMNNNGN
IQEQIVFQQEPVSPLNKAKPYEYAFNQQFEYIPKKQVNTNNTQEQIIFSQPQNNKRTVGY
EYAFGQQFNYIPKKQMNNNDYSNTQEQIVFQQEPVSPLNKAKPYEYAFNQQFEYIPKKQV
NTNNTQEQIIFSQPQNNKRTVGYEYAFGQQFEYIPKKQVNTNNTQEQIIFFQPQNNKRTI
GYEYAFGQQFEYIPKKQVNNTQEKIIFTNNSVVNKGQTYEYNSKVSYIPKKWNV
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattcaaaaaaaataaaaaaataaaaaaaatttcaaaaaaaacaactgatgaa
ttatttgttgaaaatagtttaattttgccagttgagaatgagaataaaacaaatgaagta
aatctttataattcaaaatcatatgctggtccttatcgtttcgatccttttaaaaataaa
aatatagaaacaaatactttagacttaaaagttgcagcaacattttttccgagcgggaaa
gaatctattagcaatattaattcatttaaaaaaagtaataagaattatgaaattgaaact
aatttaggaaataattttgaaaataaaattgaaagtgaccttatttttccaggatattta
gaaaactttaaaagaacaaataaaacttttcgtgaagaatcaaagattcaaaaaaatcct
ataaatgaatatgaaaataattcatttcatgatttaaataaaaaacttgattttagtgaa
tatgatttttctaaattaaaagatttttcaaacaataaaattgaaaaagaagaatacaaa
gaaatattttcaaattcttactcaaacacacaagaaaattcattggcagtaaataaaatt
gaaacaaataatttaaatcaaaaagagtattctttaggtgatttttcagaaactattttt
attcaaaatgatgcgagccaacaaaatcaagatgtttcaaattttcctaatttggaaaaa
acaaaagatgatcttaattttaatacgggatcaaaaaatgaaattgaaaatagtgatttt
ttccagtcatcttttaattcaaattcagatacttttaatcaaaataaaaatgttaaagaa
tatagtatcccaaaaccagaatatattcctaaaaaacaagtgaatacaaataatactcaa
gagcaaatcgtttttcaacaagagcctgttagtcctttaaacaaggcaaaaccatatgaa
tatgcttttaatcaacaatttgaatatattcctaaaaaacaagtgaatacaaataatact
caagaacaaattgtttttcaacaagaacctgttagtcctttaaacaaggcaaaaccatat
gaatatgcttttaatcaacaatttgaatatattcctaaaaaacaagtgaatacaaataat
actcaagagcaaattattttttcacaaccacaaaataataaaagaactgttggatacgaa
tatgcctttggacaacaatttaactatattcctaaaaagcaaatgaataataatggtaat
attcaagaacaaattgtttttcaacaagaacctgttagtcctttaaacaaagcaaaacca
tatgaatatgcttttaatcaacaatttgaatatattcctaaaaaacaagtgaatacaaat
aatactcaagagcaaattattttttcacaaccacaaaataataaaagaactgttggatac
gaatatgccttcggacaacaatttaactatattcctaaaaagcaaatgaataataatgat
tatagtaatactcaagagcaaattgtttttcaacaagaacctgttagtcctttaaacaag
gcaaaaccatatgaatatgcttttaatcaacaatttgaatatattcctaaaaaacaagtg
aatacaaataatactcaagagcaaattattttttcacagccacaaaataataaaagaact
gttggatacgaatatgcctttggacaacaatttgaatatattcctaaaaaacaagtgaat
acaaataatactcaagagcaaattattttttttcagccacaaaataataaaagaactatt
ggatatgaatatgcttttggacaacaatttgaatatattcctaaaaaacaagtgaacaac
actcaggaaaaaataatttttacaaataattcagttgttaataaaggacaaacatatgaa
tataattcaaaagttagttacattccaaaaaaatgaaatgtttaa

DBGET integrated database retrieval system