KEGG   Mycoplasma mobile: MMOB3150Help
Entry
MMOB3150          CDS       T00176                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  
methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mmo  Mycoplasma mobile
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    MMOB3150 (metS)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMOB3150 (metS)
Enzymes [BR:mmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MMOB3150 (metS)
Amino acid related enzymes [BR:mmo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MMOB3150 (metS)
Transfer RNA biogenesis [BR:mmo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MMOB3150 (metS)
 Prokaryotic Type
   Other AARSs
    MMOB3150 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(386579..388108)
Genome map
AA seq 509 aa AA seqDB search
MKKFYISTPIFYPNGDLHLGHLYSMSIAWAIRNYKKLKGYQTLLLTGSDEHGQKIMQSAE
KNNLSPKNFVDQQAEKFKSFWKKFDIEYDVFVRTTDKKHNSVIEKILTKLNENNFIYKSF
YEGLYSISDEEFLTKTQAKEVNGKFFHPVSNHELKIVKEESYFLKISQFQNWLKKYLEDY
PNFISSQKVINELKSTFLNEKLEDLSISRNSFDWGIKFSFDNKHIAYVWVDALFSYLSPL
ELFLNQEKFNSSWNDDVEKIHVVGKEITRFHGIYWPIMLKMLNLPLPNKILSHGWLITST
GKMSKSKGNIVNPLDLLEEFDSETIKLYLLSAFSINRDGVFDKENIKFFYNSFLANNYGN
LISRVSSLFSQNFSSKISWDQNSLDKIDYSILDKIEKSKEDFMSNFDNFEIDKAVEILIK
LGNELNGYVDLTKAWLLKDDKKRLATILLILINGIYAMSAYLKIFMPLKIEKIERDFFQQ
NASLENIENWKKFDDIFIKKIESIFNRIK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttacattagcacacctattttttatcctaatggggatttgcatttgggg
catttatattcaatgagtattgcctgggctattagaaattataaaaaattaaaaggttat
caaactttacttttaacaggttctgatgaacatggtcaaaaaattatgcaaagtgcagaa
aaaaataatttgagccctaaaaattttgtggatcaacaagcagaaaaattcaaatctttt
tgaaaaaaatttgatatagaatatgatgtttttgtaagaaccactgataaaaaacataat
agtgtaattgaaaaaattctaactaaattaaatgaaaataattttatttataaaagtttt
tatgaaggtttgtactctatttctgatgaagaatttttaacaaaaacacaagctaaagaa
gtgaacggaaagttttttcatcctgtttcaaatcatgaattaaaaattgtaaaagaagaa
tcttattttttgaaaattagtcaatttcaaaattgattgaaaaaatatcttgaagattat
cctaattttatctcctcgcaaaaagtaataaatgaactaaaaagtacttttttaaatgaa
aaattagaagatttatcaataagcagaaatagttttgattgaggaattaaattttcattt
gataataaacatattgcatatgtatgagttgatgcattgttttcttaccttagtccttta
gaattatttttaaatcaagaaaaatttaattcttcatgaaatgatgatgtggaaaaaata
catgttgttggaaaagaaattacaagatttcatggaatttattggccaataatgttgaaa
atgttaaatttaccattaccaaataaaattcttagtcatggatgattaattacatctaca
ggaaaaatgtcaaaatcaaaaggaaatattgtgaatcctttagatcttttagaagaattt
gatagcgaaacaattaaattatatttattaagcgcttttagtattaatagagatggtgtt
ttcgataaagaaaatattaaatttttttacaattcttttttagcaaataactatggaaat
ttgattagtagagtttcaagtctatttagtcaaaatttttcttctaaaataagttgagat
caaaattctttagataaaattgattatagtattttggataaaatcgaaaaatcaaaagaa
gatttcatgtctaattttgacaactttgaaattgataaagctgttgaaattttaattaaa
ttaggaaatgaattaaatggatatgtagatttaacaaaagcttgattgcttaaagatgat
aaaaagagattagctactattttattaattttaattaatggaatttatgcaatgagtgct
tatttaaaaatctttatgcctttaaagattgaaaaaatagaaagagatttttttcaacaa
aatgcttctttagaaaatatagaaaattgaaaaaaatttgatgatatatttatcaaaaaa
attgaatctatttttaatagaataaaataa

DBGET integrated database retrieval system