KEGG   Mycoplasma mobile: MMOB3180Help
Entry
MMOB3180          CDS       T00176                                 

Definition
(GenBank) predicted acetyltransferase
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1
Motif
Other DBs
NCBI-ProteinID: AAT27804
UniProt: Q6KHX2
Position
complement(393544..394077)
Genome map
AA seq 177 aa AA seqDB search
MNHIIKKLDRKMEDQWLDYVEEFKKFQEILVPDFSNLNFKNLRFDLKHSKNPKYLPNNWV
PYEILFLVEKDTNFIIGAISIRYELSDYLYKIGGNIGYGIRPTQRGKNNGTTLLFLGLKY
LKENLSKHKLEKVLITCDERNIASKKIILKNGGIWENTIYDYEFKRYVERYWIYLNN
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatataataaaaaaacttgatcgaaaaatggaagaccaatgattagattatgtt
gaagaatttaagaaatttcaggaaattttagttcctgatttttcaaatcttaattttaaa
aatttgcgattcgatttaaaacattcaaaaaatccaaaatatttacctaataattgagtg
ccttatgaaattctttttttagttgaaaaagatactaattttattattggagcaattagt
attcgctatgaattatcagattatttatataaaataggtggaaatattggttatggtatt
aggcctacccaaagaggaaaaaacaatggaacaacactactttttctaggtttaaaatat
ttaaaagaaaatttgtcaaaacataaattagaaaaagttctaattacatgtgatgaaaga
aatattgcttcaaaaaaaattattttaaaaaatggtggcatttgagaaaatacaatctat
gattatgaatttaaacgttatgttgaacgttactggatttatttaaataattag

DBGET integrated database retrieval system