KEGG   Mycoplasma mobile: MMOB3230Help
Entry
MMOB3230          CDS       T00176                                 

Gene name
mvspC
Definition
(GenBank) variable surface protein mvspC
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_17
Motif
Other DBs
NCBI-ProteinID: AAT27809
UniProt: Q6KHW7
Position
complement(400037..401668)
Genome map
AA seq 543 aa AA seqDB search
MNKKNMILGSIAVPLATATVIGPVVATISPNANIDSITLRKEFETIDRLDIKELATTSLP
SVVTNANINDYIISPSPRNGINFSLRLPNPNEFNDENGTISVFLIGTRNNESRSKKILVT
NFRATDEILGINAIIDNELKLITNIETTAIAKTTLPSEVTQENIDSYLITPRTSNGVVFQ
LELNNPSTFNDSTGILEFSLKASMSQIVRTKNVSVILQTSTQRVEQVLQTINNTSFTIEN
ISNRLASSIVNSDIILNPTTLEKVNLSFSIKNANDTQGILSLEVIGSLSNSTISKQISIL
GFPTKEKAFADAIGLLNGTVNTNFFTPSRTNLNPTNFTDFQTKLAQIGFISKHDFGIATS
RVSVTNYQISTINNAPFNETTRDVRIVVRGTLDNENFSFTRDLTGYTPINDDVLNKLFTI
NEFAVGSLGPNLSQRNNNVNDLAKFLLENRTNIALFYGSAWDTDRNGAVILVNGIPAISP
EFRLRGLRYHIPFVRWEIADSVTSNGRIVSQRLIIRFRFDETIGANDFLSGFNFEISKTI
RSV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaaacatgattttaggatctattgcagttcctcttgcgacagcaacagtt
attggtccggttgtggctaccataagtcctaatgcaaatatagattcaattactttaaga
aaagaatttgaaacaatcgatagattagacattaaagaattggcaaccacatctttacct
tcggtagttacaaatgcaaatattaatgattatattatttctccaagtccgagaaatggt
attaatttttctttaagattaccgaatcctaatgaatttaatgacgaaaatggaacaatt
tcagtttttttaataggaacaagaaataatgaaagtagatctaaaaaaattttagttaca
aattttagagctactgatgaaattttaggaataaatgcaattattgataatgaattaaaa
cttataacaaatattgaaacaacggctattgcaaaaacaaccttaccttcagaagtaact
caagaaaatattgattcttatttaataaccccaagaacaagtaatggtgttgtttttcaa
ttggaattaaataatccaagtacttttaatgattcgacagggattttagaattttcttta
aaagcttcaatgagtcaaatagttagaacaaaaaatgttagtgttatattgcaaacatct
actcaaagagtagaacaagttttacaaacaattaataatacaagttttacaattgaaaat
atatcaaatagattagcttcaagtattgtaaattctgacattatattaaatcctactact
ttagaaaaagttaatttgtcattttcaattaaaaatgcaaatgatactcaaggtatttta
tcattagaagttataggtagtttatcaaatagcactatttcaaaacaaatatctatttta
ggttttcctacaaaagaaaaagcttttgcagatgctattggtttattaaatggaacagtc
aatactaatttttttaccccttcaagaactaatttaaatccaactaatttcactgatttt
caaactaaattagctcaaattggttttatttctaaacatgattttggaattgcaacttca
agagtttctgttactaactatcaaattagtaccataaataatgctccttttaatgaaaca
acaagagatgtaagaattgttgttagaggaactttagacaatgaaaactttagttttact
agagatttaacaggttatacaccgattaatgatgatgttttaaataaattatttacaata
aacgaatttgctgtaggttctttaggtcctaatctttcacaaagaaataataatgtaaat
gatcttgctaaatttttattagaaaatagaacaaatattgcattattttatggtagtgct
tgagatacagacagaaatggagcagttattcttgtaaatggcattcctgctatttctcca
gaatttagattaagaggattaagatatcatattccttttgtaagatgagaaatagcagat
tcagtaacaagtaatggaagaatagtttctcaaagattgataataagatttagatttgat
gaaactataggagctaatgactttttaagtggatttaattttgaaatttcgaaaactata
agaagtgtataa

DBGET integrated database retrieval system