KEGG   Mycoplasma mobile: MMOB3300Help
Entry
MMOB3300          CDS       T00176                                 

Gene name
mvspF
Definition
(GenBank) variable surface protein mvspF
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(410924..413470)
Genome map
AA seq 848 aa AA seqDB search
MKKSIIILGITSASMLTTVIAGPSIATVMNKKSLTSEQIVQAEITKINQLELTSFGKNIL
ASEVTNLNIALSILVPNTTLSGIRFSLKLQEPSIVNDAEGSLGVVLVASLDNSIQEKKIN
VNGFRVNNQNEINAKIDLEIQNELDIINTLITKNLASSTLASNVNDTNINDFINTPVSIN
GVVFSLKVQLNGANNTTGTLGVVLIGSKSGRSLNKNINVSGFRIFNEVEAVENLLLDILG
RISTISTTTLAKTVLPSSVTPQNINQYLILPSIDLATGVTLRLRVGQINSQNDFNGTLPV
VLEASRNNITREKNFAVSGFATLSEIVNEVTRMEIQTELNKITGISLTPAAATALPSIVN
NANITQYLQIPATSNGVIFSLKTQNPSVFNDVDGQISVILTGTRSNISVEKTFSVQGFNT
NSNIINAQITADINKELARIVSIATKPAASSVLPSLVNNQNINEYLNAPNLSNGVSFKLE
LQSPLIFNDRNGSLTINLVASKSGISSTKSIEVSGFMRRITFEFNQITSLSLRAGSSTVL
PTITNDNPNLDSFINVPAISNGVSFSISFPSGISQNNQRGTHDVVLTASQVGQTSLSKTI
TTTGWLSTAQLFTKLNQTNIPLNETNHYLGQAYDWLFKGPVGRLNFRNLLREHYLKGANT
SDTAYTNSINSLIRNDLSVDGLSIQTRNNQRTLVVNFTAPNSITLTEKISHLETGARKGE
FELGNFSNLTIASVDTLSQVGLNARPITVVDGLSLVDKQPPYIVNSFSFSNGSTSVQQNS
ISNSGWIIYANGNNLSISSKIFNDGRDRSILGNTNIKITDLAFGPTNGINYKQNGTSISL
FSKEHYGL
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaattataattttaggaataacatcagcaagcatgctaacaacggttatt
gcagggccaagtattgctactgtaatgaataaaaaaagtcttacaagcgaacaaattgta
caagcagaaattacaaaaatcaatcaattagaattaacttcttttgggaaaaatatttta
gcttcagaagtaacaaatttaaatattgctttgtcaattttagtgccaaataccacatta
agtggaatacgtttttctttaaaattacaagaaccaagtattgtaaatgatgctgaaggt
agtcttggagttgttttagtggcctctttagataattcaatacaagaaaaaaagattaat
gtaaatggttttagagtaaataatcaaaatgaaataaatgcaaaaattgatcttgaaatt
caaaatgaattagacattataaatacattgattaccaaaaatttagcatcttctacttta
gcttcaaatgttaatgatacaaatattaatgattttatcaatactccagtttcgattaat
ggtgtagtattttctttaaaagttcaattaaatggtgcaaataatacaacaggtactctt
ggagtagttttaatcggatctaaatcaggaagatctcttaataaaaatattaatgtaagt
ggttttagaatctttaatgaagttgaagcagttgaaaatttacttttagatattttagga
agaatttctacaatttcaacaactactttagcaaaaactgttctcccttcatctgtaaca
cctcaaaacataaatcaatatttaattttaccttcaattgatttagcaacaggtgttact
cttagattaagagttggacaaataaattctcaaaatgatttcaacggtactttaccagtt
gttttagaagcatcaagaaataacattactagagaaaaaaactttgctgtttcaggtttt
gctaccttatcagaaattgttaatgaagttacaagaatggaaattcaaacagaattaaat
aaaattactggtattagtttaactcctgcagctgcaactgctttaccttcaatagttaat
aatgcaaatattacccaatatttacaaattccagctacttctaatggcgtaatttttagc
ttaaaaactcaaaatccaagtgtttttaatgatgttgatggtcaaatttcagttatttta
acaggaactagatcaaatattagtgtcgaaaaaacttttagtgtccaaggttttaacact
aattcaaatattattaatgctcaaatcacagctgacattaataaagaattagcaagaatt
gtttcgattgcaactaaaccagcagcttcaagtgttttaccttcattagttaataatcaa
aatattaatgaatatttaaatgcacctaatttatctaatggcgtaagttttaaattagaa
cttcaaagtccacttatttttaatgatagaaatggttcattaacaattaatttagttgct
tcaaaatcaggtatttcaagtactaaaagtattgaagtatcaggattcatgaggagaatt
acttttgaatttaatcaaattacttctttatctctaagagcaggatcttcaacagtttta
ccaactataacaaacgataatccaaatttagattcatttattaatgttccagcaatttct
aatggcgtaagtttttctataagtttcccttcagggataagtcaaaataatcaaagagga
actcatgatgttgttttaacagcttcacaagttggtcaaacaagcttatcaaaaacaatt
acaactacaggatgattatcaactgctcaattatttacaaaacttaaccaaacaaatatt
cctttaaatgagacaaatcattatttaggtcaagcgtatgattgattatttaaaggtcca
gttggaagattaaattttagaaatttattaagagaacattatttaaaaggagcaaatact
tcggatacagcatatacaaattctattaattcattaataagaaatgatctttcagtagat
ggtttaagtattcaaactagaaataaccaaagaactttagttgtaaattttactgctcca
aatagtattactttaacagaaaaaatttctcatctagaaacaggggctagaaaaggagag
tttgagcttggtaatttttcaaatttaacaatagcatcagttgatactttaagtcaagta
ggattaaatgctagacctataacagttgtagatggattatctttagttgataaacaacct
ccatatattgtaaatagtttttcattttcaaacggatcaactagtgttcaacaaaattca
atttctaattcgggatgaatcatttatgctaatggtaataatctatcaatttcttcaaaa
atttttaatgacggtagagacagatcaattttaggaaatacaaatattaaaattacagat
ttagcttttggtcctacaaatggaattaattataaacaaaatggaacaagcatttcttta
ttttctaaagaacactatggattgtaa

DBGET integrated database retrieval system