KEGG   Mycoplasma mobile: MMOB3330Help
Entry
MMOB3330          CDS       T00176                                 

Gene name
mvspH
Definition
(GenBank) variable surface protein mvspH
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(416310..417302)
Genome map
AA seq 330 aa AA seqDB search
MKIKNKYLIGIGTLSTIAILPITVVACGTTTSESAENFKKIDLELEKIISANFKVTNNTK
LASEINAANLQTEITKNFNNTINSVNFTYSISTKTAINDEIGTLTLTLTGQIGTDSRTKE
ITITGFETATQRKAKIKVELEKLNLVKIGAFATTLPSEVKLDNVNTFFEALPEANGVSFK
SSLISLENNVDGTLTITIEGSIGKVIETKTFPITGFQKLDQRNQILDNELAKIANLTLKG
DFATTLPSEVTADNIRELITTPEPINGVIFRIFWTPQNEEEKNLSDSTGTLKFRIDAFTN
ENPLIFRDKEFSVSGFRMNSQSLLGEIKKI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaacaaatatttaattggaattggtacactaagtacaattgcaatttta
ccaataacagttgtagcatgcggaacaacaacatcagaaagtgctgaaaattttaaaaaa
atcgatctagagcttgaaaaaattatatcagctaattttaaagtaacaaataatacaaaa
ttagcttcagaaattaatgcagctaatttacaaactgaaataacaaaaaattttaataat
actattaatagtgtaaattttacttattctatttcaacaaaaactgctataaatgatgaa
ataggcactttaactttaacactaacagggcaaattggaactgatagtagaacaaaggaa
attactattacaggatttgaaacagcaactcagagaaaagctaaaattaaagtagaactt
gaaaaactaaatctagtaaaaataggcgcttttgcaactactttaccttcagaagtaaag
cttgataatgttaatactttctttgaagctttaccagaggcaaatggagtaagttttaaa
agttcattaattagtttagaaaataatgttgatggaactcttactattacaattgaaggt
tctattggaaaagtaattgaaactaaaacttttcctattactggattccaaaaattagat
caaagaaatcagatattagataatgaattagcaaaaattgctaacttaactcttaaagga
gattttgcaactactttaccttcagaagtaactgctgataatataagagaattaattact
actccagaacctattaatggtgtaatttttagaatattttgaacaccacaaaatgaagaa
gaaaaaaatcttagtgattcaacaggaacattaaaatttagaattgatgcttttacaaat
gaaaatcctttaatatttagggacaaagagttttcagtttcagggtttcgaatgaattca
caaagtttattaggtgaaattaaaaaaatttaa

DBGET integrated database retrieval system