KEGG   Mycoplasma mobile: MMOB4190Help
Entry
MMOB4190          CDS       T00176                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmo  Mycoplasma mobile
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMOB4190 (tpiA)
   01230 Biosynthesis of amino acids
    MMOB4190 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB4190 (tpiA)
   00051 Fructose and mannose metabolism
    MMOB4190 (tpiA)
   00562 Inositol phosphate metabolism
    MMOB4190 (tpiA)
Enzymes [BR:mmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MMOB4190 (tpiA)
Exosome [BR:mmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MMOB4190 (tpiA)
  Exosomal proteins of bladder cancer cells
   MMOB4190 (tpiA)
  Exosomal proteins of melanoma cells
   MMOB4190 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522626..523354)
Genome map
AA seq 242 aa AA seqDB search
MRKKIIIGNWKMNKTKTEAENFVKEFNKITSELNLKLDKNLVAGLALPFTSLGIKKEGNF
ANLVIAAQNFHQNNSGAFTGEISAEMLLDLGVKMVVLGHSERREFFHETDEIVNMKMHQA
IKNNLVPIVCVGETELQYNSNKSKEVIKNQIEKSLKNLSDFSKIIIAYEPIWAIGTGKTA
TVEYAQEMCKYIRSLTNEKTIIQYGGSVKPNNIKELLSQKDIDGALVGGASLNVKDFIDL
IK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattattattggtaattgaaaaatgaacaaaactaaaacagaagcagaa
aattttgtaaaagagtttaataaaattacaagtgagttaaacttgaaattggacaaaaat
ttagttgcaggtttagcattaccattcacatcattagggattaaaaaagaaggaaatttt
gcaaatttagttattgctgcacaaaattttcaccaaaataatagtggagcctttacagga
gaaatttcagcagaaatgcttttagatctaggggtaaaaatggttgttttaggtcatagt
gaaagaagagagttttttcatgaaactgatgaaatagtaaacatgaaaatgcatcaagca
attaaaaataatttagtcccaattgtttgtgttggagaaacagaactacaatacaattcg
aacaaatctaaagaagttataaaaaatcaaattgaaaaatcactaaaaaatttaagtgat
ttttcaaagattattattgcttatgaaccaatttgggcaattggtacaggaaaaacagct
acagttgaatatgcccaagaaatgtgtaagtacattagaagtttaacaaatgaaaaaaca
attattcaatatggcggaagtgtaaaaccaaataatattaaagaattgttaagtcaaaaa
gatattgatggtgctcttgttggtggagcttctttgaatgtaaaagattttattgattta
attaaataa

DBGET integrated database retrieval system