KEGG   Mycoplasma mobile: MMOB4190Help
Entry
MMOB4190          CDS       T00176                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmo  Mycoplasma mobile
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mmo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522626..523354)
Genome map
AA seq 242 aa AA seqDB search
MRKKIIIGNWKMNKTKTEAENFVKEFNKITSELNLKLDKNLVAGLALPFTSLGIKKEGNF
ANLVIAAQNFHQNNSGAFTGEISAEMLLDLGVKMVVLGHSERREFFHETDEIVNMKMHQA
IKNNLVPIVCVGETELQYNSNKSKEVIKNQIEKSLKNLSDFSKIIIAYEPIWAIGTGKTA
TVEYAQEMCKYIRSLTNEKTIIQYGGSVKPNNIKELLSQKDIDGALVGGASLNVKDFIDL
IK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattattattggtaattgaaaaatgaacaaaactaaaacagaagcagaa
aattttgtaaaagagtttaataaaattacaagtgagttaaacttgaaattggacaaaaat
ttagttgcaggtttagcattaccattcacatcattagggattaaaaaagaaggaaatttt
gcaaatttagttattgctgcacaaaattttcaccaaaataatagtggagcctttacagga
gaaatttcagcagaaatgcttttagatctaggggtaaaaatggttgttttaggtcatagt
gaaagaagagagttttttcatgaaactgatgaaatagtaaacatgaaaatgcatcaagca
attaaaaataatttagtcccaattgtttgtgttggagaaacagaactacaatacaattcg
aacaaatctaaagaagttataaaaaatcaaattgaaaaatcactaaaaaatttaagtgat
ttttcaaagattattattgcttatgaaccaatttgggcaattggtacaggaaaaacagct
acagttgaatatgcccaagaaatgtgtaagtacattagaagtttaacaaatgaaaaaaca
attattcaatatggcggaagtgtaaaaccaaataatattaaagaattgttaagtcaaaaa
gatattgatggtgctcttgttggtggagcttctttgaatgtaaaagattttattgattta
attaaataa

DBGET integrated database retrieval system