KEGG   Mycoplasma mobile: MMOB4610Help
Entry
MMOB4610          CDS       T00176                                 

Definition
type III restriction-modification system methylase (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mmo  Mycoplasma mobile
Brite
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     MMOB4610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576815..578464
Genome map
AA seq 549 aa AA seqDB search
MSKKEKIIEKIKAYDRSYFNDDQKIIAIEIIKNCPEKEVQSYFDFIQFKRNTGFVFDYAP
EIAKGRLITLRENVGKRINVFNEIQNDENKLIIGDNYNALKSLKITHKGKINIIYIDPPY
NTESALKDGNSSSKEKITSTSKFAYKDKFGRGGWLNMINERLILAKDLLTDEGLIFVSID
DSEQAYLKVLMDNIFGEDNFVNQIAWVSNKKGRQISNSLLAKTYEYILIYSKNSDKEFKF
NKLDQEYAKKIMPSIYEKTDYEIMRDEYGEFVIKNELHNSNIKAFNINTRKNLFFPLFII
ENEIFTNDTKNRNQKIVFPPKNQEGLQGVWRWSKEKIENSKQDLYIDEKNNQIKIYTKIR
DMSIFPKDVILSPKISTKSGTSEFLQIFEEEKFQYPKPVELLKFLIKISGNKNSIVLDFF
AGSGTTGQAVLELNKEDGGNRNFILCTNNENNIAEEISYERLFRIITGKTTDGNKKFKWL
DKNEPFYGAKLRVINIDDSIKISLNDQVSENVYYDCVKGLKLLNNNYNKEGLELFYDLSA
LNPINEEVV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaagaaaaaataatagagaaaattaaagcttatgatagatcatattttaat
gatgatcaaaaaataattgcaatagaaattattaaaaattgtccagaaaaagaagttcaa
tcttattttgattttattcagtttaaaagaaatacaggattcgtatttgattatgcacca
gaaattgcaaaagggaggttaataactttaagggaaaatgttggaaaaagaattaatgtt
tttaacgaaattcaaaatgatgaaaataaattaattattggagataattataatgcatta
aagtcacttaaaattactcataaaggcaaaattaatataatttatatagatcctccttac
aatacagaatctgctctaaaagacggaaatagttcatcaaaagaaaaaattacttctaca
tctaaatttgcatataaagataaatttggacgtggaggatgacttaatatgataaacgaa
agattaattttagcaaaagatcttttaacagatgaaggtttaatttttgtttcaattgat
gattctgaacaagcttatttaaaagttttaatggataatatatttggagaagataatttt
gtaaatcaaattgcttgagtgtctaataaaaaaggaaggcaaatttctaattctctttta
gcaaaaacttatgaatatattcttatatatagtaaaaattctgataaagaatttaaattt
aataaattagatcaagaatatgcaaaaaaaattatgccatctatttacgaaaaaacagat
tatgaaattatgagagatgaatatggggaatttgtgataaagaatgaacttcataattcg
aacataaaagcttttaacataaatacaagaaaaaatctattttttcccttatttattatt
gaaaatgaaattttcacaaatgatacaaaaaatagaaatcaaaaaattgtttttccacca
aaaaatcaggaagggttacaaggtgtttgaagatgatcaaaagagaaaattgaaaatagc
aagcaagatttatatattgatgaaaaaaataaccaaataaaaatatatacaaaaataaga
gacatgagcatttttccaaaagacgtaatcttatctccaaaaatttctacaaaatcaggt
acttcagaatttttgcaaatttttgaagaagaaaaatttcagtatccaaaaccagtagaa
ttattaaaatttttaataaaaatatcagggaataaaaattcaatagtattagattttttt
gcaggttcaggaacaacaggtcaagctgttctagagttaaataaagaggatgggggtaat
agaaattttattctttgtacaaataatgaaaataatattgctgaagagatatcttatgaa
aggttatttagaataattacaggtaaaacaacagatggaaataaaaaatttaaatgatta
gataaaaatgaacctttctatggtgcaaaattaagggtaataaatattgatgatagtatt
aaaatttctttgaatgatcaagtttctgaaaatgtttattatgactgtgtaaaaggttta
aaattactaaataacaattacaacaaagaaggtttagaattgttttatgatctttctgct
cttaatccaattaacgaggaagttgtttaa

DBGET integrated database retrieval system