KEGG   Mycoplasma mobile: MMOB5360Help
Entry
MMOB5360          CDS       T00176                                 

Gene name
deoA
Definition
(GenBank) pyrimidine (thymidine)-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00240  Pyrimidine metabolism
mmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MMOB5360 (deoA)
Enzymes [BR:mmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MMOB5360 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAT28022
UniProt: Q6KHA8
Position
669922..671223
Genome map
AA seq 433 aa AA seqDB search
MKATDIIQKKLRKESLTKTEIDFFISKFMINEIKDYQMTALNTAIFLNGLNEEEITYLTL
AMLDSGEKLNLSSLKGPKADKHSTGGVGDKMTLIIGPMAAALGIKMAKMSGRGLGFTGGT
LDKLESIPGFKIDISEKKFIEQVDRINFALVSQNKNLAPADKRIYDLRNDTGTVDSIALI
AASIMSKKFASGAEIILLDVKCGTGAFIETLDKARELAKLMVKIGHLANKTVKAEITNMN
EPLGKMIGNRNEVYEVKKFFENPNNYPDLKELAYTTVESLLLTSKIATTEKDANTLIENV
MNSGNALQRFYNFIEAQGGDTKKLREDKLWNPKKSLEVKSYTNGFLEIINAKIFGIVAND
LGAGRYLKEDKIDYEAGIELHKKTNDLVKKGDVLFTLYSSKKIEQKLVDDLLKAIKINES
QIQKQNIIIERIE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctacagatataattcaaaaaaaacttagaaaagaatctttaacaaaaacagaa
attgatttttttatttctaaatttatgattaatgaaataaaagactaccaaatgaccgca
ctaaatacagcaatttttttaaatggtctaaatgaagaggaaatcacttatctaacacta
gctatgcttgattctggagaaaaacttaatttaagttctttgaaaggtccaaaggctgat
aaacactctacaggaggggttggagataaaatgactcttatcattgggcccatggctgct
gctttaggaataaaaatggcaaaaatgagtggtcgtggtttaggttttacaggaggaact
cttgataaactagaatcaattcctggttttaaaattgatattagtgaaaaaaaatttatt
gagcaagtagatagaataaattttgctcttgtatcccaaaataaaaacttagctcctgct
gataaaagaatttatgacttaagaaatgacacaggaactgttgattcaattgcattaatt
gcagctagtattatgtcaaaaaaatttgcttcaggtgcagaaattattttgttagatgta
aaatgtggaactggagcttttattgaaacattagataaagctagagaattagcaaaattg
atggtaaaaataggtcatctagcaaataaaaccgttaaagccgaaattacaaacatgaat
gagcctttaggaaaaatgattggaaatcgtaatgaagtttatgaagttaaaaaattcttt
gaaaatccaaataattatcctgatttaaaagaactagcatatacaacagtagaatcttta
ttacttacaagtaaaatagcaacaactgaaaaagatgcaaatactttgattgaaaatgtt
atgaattctggaaacgcattacaaagattctacaattttattgaagcacaaggtggagat
actaaaaaattaagagaagataaattatgaaatcctaaaaaatctttagaagtaaaatct
tatactaatggatttttagaaataattaatgcaaaaatttttggaatagttgctaatgat
ttaggtgctggaagatatttaaaagaagataaaatagattatgaagcaggaatagaactt
cataaaaaaactaatgatttagtaaaaaaaggtgatgttttatttactttatattcttca
aaaaaaatagagcaaaaattagttgatgatttactaaaggcaataaaaataaatgaatct
caaattcaaaaacaaaatatcattattgaaaggatagaataa

DBGET integrated database retrieval system