KEGG   Mycoplasma mobile: MMOB5570Help
Entry
MMOB5570          CDS       T00176                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mmo  Mycoplasma mobile
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mmo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690763..691368
Genome map
AA seq 201 aa AA seqDB search
MCIILIMHHGKIIILSGPSGVGKGSIEKLLLEDEKLKLKFSTSVTSRKPRVNEIEGKDYF
FRSEEEFSELIKEKKFIEWSRHLNNYYGTLKSEVDKILGAKFNVLIEIETTGALNILKYY
KKKNMLNDVISIFILPPRLEELETRILNRGSETKEEIKIRIKKAKKEIKLKNKFKYNLTN
NFLHECVEEVKNILKREIHEI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtataattttaattatgcatcatgggaaaattataattttatctgggccttcagga
gtaggtaaaggttcaattgaaaaattacttttagaagatgaaaaattgaaattaaaattt
tcaacatctgtaacatcaagaaaaccaagagtaaatgaaattgaaggaaaagattatttt
tttagaagcgaagaagaattttcagaattaatcaaagaaaaaaaatttattgaatgaagt
aggcatttaaataattattatggaactttaaaatctgaagtagataaaattttaggtgca
aaatttaatgttttaattgaaattgaaacaacaggtgctttaaacatcttaaaatattac
aaaaagaaaaacatgttgaatgatgtaatttctatttttattttacctcctagattagaa
gaattagaaacaagaattcttaatagaggtagtgaaacaaaagaagaaattaagatcaga
ataaaaaaagcaaaaaaagagattaaacttaaaaataaattcaaatataatttaaccaac
aattttttacatgaatgtgtagaagaagtaaaaaatattttaaaaagggaaatacatgaa
atttaa

DBGET integrated database retrieval system