KEGG   Mycoplasma mobile: MMOB5810Help
Entry
MMOB5810          CDS       T00176                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00010  Glycolysis / Gluconeogenesis
mmo00020  Citrate cycle (TCA cycle)
mmo00620  Pyruvate metabolism
mmo01100  Metabolic pathways
mmo01110  Biosynthesis of secondary metabolites
mmo01120  Microbial metabolism in diverse environments
mmo01130  Biosynthesis of antibiotics
mmo01200  Carbon metabolism
Module
mmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB5810 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MMOB5810 (pdhC)
   00620 Pyruvate metabolism
    MMOB5810 (pdhC)
Enzymes [BR:mmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MMOB5810 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AAT28067
UniProt: Q6KH63
Position
complement(717984..719345)
Genome map
AA seq 453 aa AA seqDB search
MFKFKFADIGEGLHEGVVAEIYKKEGDMVKEGEALFSVETDKVTSDIPSPVTGKIIKVAM
FKGDTIHVGQEIYQIEDGSSSSSSVGIKTEAPKKAGGGGASVVGEVAVSDEVMSFGRVNS
NSSNSQSQVSPREIVQSASISATPENRRALARAKMLGQSVVFETNTLNSSESSNRRALAR
AKMLGQSPEIVSKPVSIQQIQQNVEKAVSNSQVQPLISLANELKREKVTPIRKAIAKAMK
NSWSNVAYTNLVNEINVGSLVSLREKIKDSVQDLTGVKVTFLPFIIKAITLALKEFPVLM
AKYDEQASELVYSGTLNIGIAVDTEAGLMVPVIKNADKLNIIEIAKEITRLAVAARDKKI
KADELKGSDFTVTNYASVGSLFGIPVINYPDMAIAGIGVIKDEPIVTKNGIVAGKIMNLT
VAADHRWVDGATIGRFAQKVKHFLENPELLGVF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaaatttgcagatattggtgaaggacttcacgaaggtgtagtagccgaa
atttataaaaaagaaggagatatggtaaaagaaggagaagctttattttctgtggaaaca
gataaagtaacttctgatattccttctcctgttacaggaaaaattattaaagtagcaatg
ttcaaaggtgatacaattcatgttggtcaagagatttaccagattgaagatggttcatca
tcaagttcttctgttggaataaaaacagaagcacctaaaaaagcaggtgggggaggagct
tctgttgttggggaagttgctgtttcagatgaagtcatgtcttttggaagagtaaatagt
aattcttcaaattctcaatctcaagtttctccaagagaaatagttcaaagtgcaagcatt
tctgcaacgcctgagaacagaagagcattagcaagagctaaaatgttaggacaaagtgtt
gtttttgaaacaaatactttaaacagtagtgaatcttcaaacagaagagcattagcaaga
gctaaaatgttaggacaaagccctgagattgtttcaaaaccagtttccattcaacaaatt
caacaaaatgttgaaaaagctgtttcaaattctcaagttcaacctttgatttctttagct
aatgaattaaaaagagaaaaagtgactcctattagaaaagctattgcaaaagcaatgaaa
aattcttgatcaaatgttgcttatactaatttagtaaatgaaattaatgttggttctcta
gtttctttaagagaaaaaattaaagattccgttcaagatttaactggagttaaagtaact
tttttaccttttataattaaagctataactttagcattaaaagaatttcctgttttaatg
gctaaatatgatgaacaagcaagcgaactagtttattcaggaactttaaatattggaatt
gcagtcgataccgaagcaggactaatggttcctgttataaaaaatgcagataaactaaat
ataattgaaattgctaaagaaattactagacttgcagttgctgctagagataaaaaaatc
aaggcagatgaactaaaaggaagtgattttacagttacaaattatgcttctgtaggttcg
ttattcggaattcctgttattaattatcctgatatggcaattgctggtattggtgtaatt
aaagatgaaccaattgttacaaaaaatggaattgttgcaggtaaaattatgaatcttact
gttgcagcagatcatagatgagttgatggggctacaattggaagatttgctcaaaaagta
aaacactttttagaaaacccagaactattaggagtgttttaa

DBGET integrated database retrieval system