KEGG   Methanococcus maripaludis S2: MMP0041Help
Entry
MMP0041           CDS       T00164                                 

Gene name
tfb
Definition
transcription initiation factor IIB
Orthology
K03124  
transcription initiation factor TFIIB
Organism
mmp  Methanococcus maripaludis S2
Pathway
Basal transcription factors
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mmp03022]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(58605..59624)
Genome map
AA seq 339 aa AA seqDB search
MKVESVTKEDTKKSERKIKIAIAKPEDYSNKNVILEKEEELICPVCGSKSIIKDYERAEI
VCEMCGCVLQQNLFDVGPEWRAFDHEQRVKRSRVGAPMTYTIHDKGLSTVIDWRNKDSYG
KDISADKRAQLYRLRKWQRRIRVSDASERNLAFALSELDRIASKLGLPRNVRENAAVLYR
GAVEKGLIRGRSIEGVAAAALYAACRRCKVPRTLDEIAEVSRVDRKEIGRTYRFISRELN
IRLAPTNPVDYVPRFASELKLPGEVESKAISILQKAGERGLTSGRGPTGVAAAAIYIASV
LQGTRRTQREVADVAGVTEVTIRNRYKELTEHLDIDVTL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaatctgttacaaaagaagatactaaaaagtctgaaagaaagattaaaatt
gctatcgcaaagcctgaagactactcaaataagaatgttattttagaaaaggaagaagaa
ttaatctgtcctgtctgcggtagtaaaagtattattaaggattatgaaagggctgaaatc
gtttgtgaaatgtgtggatgtgttttacagcagaatttatttgacgtgggtcctgaatgg
agagcctttgatcacgaacagcgtgtaaaaagaagtagggttggagccccaatgacttat
acaatccacgataaaggtttatcaacagttatcgactggagaaataaagacagctacgga
aaagatatttctgcagataaaagagctcaactttatagattaagaaaatggcagagaaga
atcagggtttctgatgcatctgaaagaaacttagcctttgcactttccgaacttgacagg
atagcttcaaaattgggtcttccaagaaacgttagggaaaacgctgcagttctttacagg
ggtgctgtagaaaaagggttaattagaggaagaagtattgaaggtgttgccgctgctgca
ctctacgctgcatgcagacgatgtaaggttccaagaactcttgatgaaattgcagaagtt
tcaagagtcgatagaaaagaaattggaagaacatatagatttatttcaagagaattaaac
atcaggcttgctccaacaaatcctgtggattatgttccaagattcgcttcagaattaaaa
cttccaggagaagttgaatcaaaagcaatatcaatcttgcagaaagcaggagaacgcggt
cttactagtggtagaggacctactggagttgccgctgctgcaatttatattgcaagtgtt
ttacagggaactagaagaactcagagggaagttgcagatgttgcaggagttactgaagtt
acaataagaaataggtacaaagagctaacagaacacttagatatcgatgtaacattataa

DBGET integrated database retrieval system