KEGG   Methanococcus maripaludis S2: MMP0041Help
Entry
MMP0041           CDS       T00164                                 

Gene name
tfb
Definition
(GenBank) transcription initiation factor B
  KO
K03124  transcription initiation factor TFIIB
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MMP0041 (tfb)
Transcription machinery [BR:mmp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     MMP0041 (tfb)
 Prokaryotic type
  Archaeal type
    TFB
     MMP0041 (tfb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIB TF_Zn_Ribbon Sigma70_r4 RPA_interact_C HTH_AsnC-type UPF0253 Lar_restr_allev QVR Ribosomal_S27e
Motif
Other DBs
NCBI-ProteinID: CAF29597
UniProt: Q6M176
Position
complement(58605..59624)
Genome map
AA seq 339 aa AA seqDB search
MKVESVTKEDTKKSERKIKIAIAKPEDYSNKNVILEKEEELICPVCGSKSIIKDYERAEI
VCEMCGCVLQQNLFDVGPEWRAFDHEQRVKRSRVGAPMTYTIHDKGLSTVIDWRNKDSYG
KDISADKRAQLYRLRKWQRRIRVSDASERNLAFALSELDRIASKLGLPRNVRENAAVLYR
GAVEKGLIRGRSIEGVAAAALYAACRRCKVPRTLDEIAEVSRVDRKEIGRTYRFISRELN
IRLAPTNPVDYVPRFASELKLPGEVESKAISILQKAGERGLTSGRGPTGVAAAAIYIASV
LQGTRRTQREVADVAGVTEVTIRNRYKELTEHLDIDVTL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaatctgttacaaaagaagatactaaaaagtctgaaagaaagattaaaatt
gctatcgcaaagcctgaagactactcaaataagaatgttattttagaaaaggaagaagaa
ttaatctgtcctgtctgcggtagtaaaagtattattaaggattatgaaagggctgaaatc
gtttgtgaaatgtgtggatgtgttttacagcagaatttatttgacgtgggtcctgaatgg
agagcctttgatcacgaacagcgtgtaaaaagaagtagggttggagccccaatgacttat
acaatccacgataaaggtttatcaacagttatcgactggagaaataaagacagctacgga
aaagatatttctgcagataaaagagctcaactttatagattaagaaaatggcagagaaga
atcagggtttctgatgcatctgaaagaaacttagcctttgcactttccgaacttgacagg
atagcttcaaaattgggtcttccaagaaacgttagggaaaacgctgcagttctttacagg
ggtgctgtagaaaaagggttaattagaggaagaagtattgaaggtgttgccgctgctgca
ctctacgctgcatgcagacgatgtaaggttccaagaactcttgatgaaattgcagaagtt
tcaagagtcgatagaaaagaaattggaagaacatatagatttatttcaagagaattaaac
atcaggcttgctccaacaaatcctgtggattatgttccaagattcgcttcagaattaaaa
cttccaggagaagttgaatcaaaagcaatatcaatcttgcagaaagcaggagaacgcggt
cttactagtggtagaggacctactggagttgccgctgctgcaatttatattgcaagtgtt
ttacagggaactagaagaactcagagggaagttgcagatgttgcaggagttactgaagtt
acaataagaaataggtacaaagagctaacagaacacttagatatcgatgtaacattataa

DBGET integrated database retrieval system