KEGG   Methanococcus maripaludis S2: MMP0135Help
Entry
MMP0135           CDS       T00164                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MMP0135 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMP0135 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MMP0135 (thrC)
Enzymes [BR:mmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MMP0135 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141612..142826
Genome map
AA seq 404 aa AA seqDB search
MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIKEGLDEIVPDENPETIATAIRIGNP
VNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
DKDQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLRKAIEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgcagagtatgcggaaaagaatacgatgttgatgccataatttacaac
tgcgaatgtggcggattactcgaaattaaatacgattttgaaagtatcaaagaaaaagtt
tcaaaagaatccttaagggaaagagaacttggtgtatggagatatttagactacttacca
gttaaagatcctgcaaaaattgtgagccttcacgaagggggaactccactttacaaatgt
gaaaatctcgcaaaaaaattaggaatgaaagagttatatgttaaaaacgaaggtgcaaac
ccaacaggaagtttcaaagatagagggatgactgttggagttacaagagcaaacgaactt
ggtgttgaagtagtaggctgtgcttcaaccggaaacacatctgcatcacttgcagcatac
tctgcaagagcaggtaaaaaatgtattgttcttcttcctggaggaaaagtagctcttgga
aaactcgctcaggcaatgttttacggtgcaaaagttatccagatcaacggaaactttgac
gaagctcttgtaatggttaaaaaccttgcattagaaaacaaactctacttattaaactct
gtaaacccattcagacttgaaggtcagaaaacaattggttttgaaatctgcgaccagtta
gactttgaagttccagacatggttattttaccggttggaaacgctggaaacatcagcgca
atctggaaaggatttaaagaatttaaagaaacagaaatgattgacagattaccaaaaatg
actggaatccaagcagaaggtgcacagccaattgtaaaagcgataaaagaaggactcgac
gaaatagttcctgacgaaaatcctgaaacaattgcaactgcaatcagaatcggaaaccct
gtaaacgctgcaaaagcacttgatgcaatcaaatcttcaggagggcttgcagaaagcgta
aacgatgaagaaattatcgaagctcagaaactccttgcacaaacagaaggaattttcgta
gaacctgcttcagcatcatcaattgcaggtcttatcaaattgataaacatgggattaatt
gataaagatcaaaaaatcgtatgtattacaacaggtaacggattaaaagatccagatgct
gcaatcaaagcaagtaaaatgcctacagaaattgaatgcgacatggaagtactcagaaaa
gcaatagaagaataa

DBGET integrated database retrieval system