KEGG   Methanococcus maripaludis S2: MMP0135Help
Entry
MMP0135           CDS       T00164                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00260  Glycine, serine and threonine metabolism
mmp00750  Vitamin B6 metabolism
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01230  Biosynthesis of amino acids
Module
mmp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMP0135 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MMP0135 (thrC)
Enzymes [BR:mmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MMP0135 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP C1_2
Motif
Other DBs
NCBI-ProteinID: CAF29691
UniProt: Q6M0Y3
Position
141612..142826
Genome map
AA seq 404 aa AA seqDB search
MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIKEGLDEIVPDENPETIATAIRIGNP
VNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
DKDQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLRKAIEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgcagagtatgcggaaaagaatacgatgttgatgccataatttacaac
tgcgaatgtggcggattactcgaaattaaatacgattttgaaagtatcaaagaaaaagtt
tcaaaagaatccttaagggaaagagaacttggtgtatggagatatttagactacttacca
gttaaagatcctgcaaaaattgtgagccttcacgaagggggaactccactttacaaatgt
gaaaatctcgcaaaaaaattaggaatgaaagagttatatgttaaaaacgaaggtgcaaac
ccaacaggaagtttcaaagatagagggatgactgttggagttacaagagcaaacgaactt
ggtgttgaagtagtaggctgtgcttcaaccggaaacacatctgcatcacttgcagcatac
tctgcaagagcaggtaaaaaatgtattgttcttcttcctggaggaaaagtagctcttgga
aaactcgctcaggcaatgttttacggtgcaaaagttatccagatcaacggaaactttgac
gaagctcttgtaatggttaaaaaccttgcattagaaaacaaactctacttattaaactct
gtaaacccattcagacttgaaggtcagaaaacaattggttttgaaatctgcgaccagtta
gactttgaagttccagacatggttattttaccggttggaaacgctggaaacatcagcgca
atctggaaaggatttaaagaatttaaagaaacagaaatgattgacagattaccaaaaatg
actggaatccaagcagaaggtgcacagccaattgtaaaagcgataaaagaaggactcgac
gaaatagttcctgacgaaaatcctgaaacaattgcaactgcaatcagaatcggaaaccct
gtaaacgctgcaaaagcacttgatgcaatcaaatcttcaggagggcttgcagaaagcgta
aacgatgaagaaattatcgaagctcagaaactccttgcacaaacagaaggaattttcgta
gaacctgcttcagcatcatcaattgcaggtcttatcaaattgataaacatgggattaatt
gataaagatcaaaaaatcgtatgtattacaacaggtaacggattaaaagatccagatgct
gcaatcaaagcaagtaaaatgcctacagaaattgaatgcgacatggaagtactcagaaaa
gcaatagaagaataa

DBGET integrated database retrieval system