KEGG   Methanococcus maripaludis S2: MMP0148Help
Entry
MMP0148           CDS       T00164                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase, AMP-forming (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP0148 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0148 (acsA)
   00620 Pyruvate metabolism
    MMP0148 (acsA)
   00640 Propanoate metabolism
    MMP0148 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMP0148 (acsA)
   00680 Methane metabolism
    MMP0148 (acsA)
Enzymes [BR:mmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MMP0148 (acsA)
Lipid biosynthesis proteins [BR:mmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MMP0148 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
158021..159931
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKALDWNPPYAKWFKGGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREVNKFANVLENLGVEKGDVV
TIYMPMMTEAIIAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IDLKKILDKALLNCNSIKHVVYAKRGIEEFNLVSGKEYFWDELMGGAKSYVEPVPVESEH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTILYTAPTAIRMLMMYGEKWVNTHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHIIYPPIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNEKYRELPSNEVKAELIKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIMGEEIGDVTTLEDNTSLEEVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggagacaaatacataatgcttgaaaaatattcagaattacagcaaaaagct
ttggatgaccctgaaaaattctggggagagcaggccaaatgtttagaatgggataaaact
tgggataaagcactggactggaatcctccttatgcaaaatggtttaaaggcggcagtttg
aatgcaagctacaactgtgttgataggcacataaaaggaaacaggagaaataaagctgcg
ataatttgcgaaaaagaggatgggagctgcggaattttaacttattacgagttatatcgg
gaagtaaataaatttgcaaacgttcttgagaatctgggcgttgaaaaaggcgatgttgtc
acaatctacatgccgatgatgacagaggcaattattgcaatgctcgcatgttcaagaatt
ggggcaattcacaacgttgtattttctggattttcttcagatgcacttgctgatcggata
aacgattcgaaatcaaaaatattggtgactaccaatctcttatacaggcgtggaaaagag
attgatcttaaaaaaatattggataaagcattattgaattgtaactcaataaaacacgta
gtttatgcaaaaagaggcattgaagaatttaacttagtttctggaaaagagtacttctgg
gatgaattaatgggcggtgctaaaagctacgtagaaccggttcccgtggagtctgaacac
ccgctatttattctctacactagcggtacaactggaagtccaaaaggtgtagttcattca
acaggcggatatttaacttatgccacaaaaaccatggattggacatggggattaaatgaa
atggatgtattttggtgtactgcagacattggatggattactgggcacacttacgtagta
tatggtccgctttcacttggtgcaacgatagtactctacgagggtgcaatagactaccct
gaacccgacagattgtggggtattgtagaaaatcatggggttacaattctttatactgca
ccaaccgcgataagaatgcttatgatgtacggtgaaaaatgggtaaatactcacgattta
tctacattgaggcttttgggaagtgtaggggaacccataaatccaagagcttggaaatgg
tattacaaagtaattggaaaagaaaaatgtccaatttgcgactgctactggcaaactgaa
actggtgggcatattatatatcctccaattggaatccagtcagttccattaaaaccgggt
tcagcaacattccctggaatcggaattgatgttgatgttgtagacaacgaaggaaaccct
gttgatgcaaatgtaaaaggaaatctaattataaaacgaccctggccaggaatgcttgca
ggactctggaacaacgatgaaagataccgtgcggcatattgggataggttcaaaaacaaa
ttttcaacatctgactatgcaataaaagatcaggatggatacatttgggtactaggacga
tctgacgaagtattgaatgtttcaggacacaggattggaaccgcagaactcgaacacgaa
cttgtatcaaataaaatggttgcagagtctgcagtagtcggaaaaccagacgatgtgaaa
ggagaagttcctgttgcatttgttatattaaacgaaaaataccgtgaacttccatcaaat
gaagtaaaggctgaacttatcaaacatattcgagatactgtaggcccaattggaactcct
gcaatgatattctttgtaaacaaacttccaaaaacaagaagtggaaaaataatgagaaga
atattgaaaaaactcataatgggcgaagagataggcgatgttaccacattggaagacaat
acaagtttagaagaagttaaaaaagagcttgaagatttcaagtatgattaa

DBGET integrated database retrieval system