KEGG   Methanococcus maripaludis S2: MMP0253Help
Entry
MMP0253           CDS       T00164                                 

Gene name
acd
Definition
CoA-binding domain-containing protein (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0253 (acd)
   00620 Pyruvate metabolism
    MMP0253 (acd)
   00640 Propanoate metabolism
    MMP0253 (acd)
Enzymes [BR:mmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     MMP0253 (acd)
Lipid biosynthesis proteins [BR:mmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MMP0253 (acd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(253586..255694)
Genome map
AA seq 702 aa AA seqDB search
MNTLEGIFNPKSVAVIGASEIEGKVGQSVMKNLLNFKQHGGKVYPINKKYNEVYGIKCYG
SVLDVPETPDLVIISIPAEYAVDAMEECGRKGVKAAIIITAGFAETNNHVLEDRLKAIID
QYGIRTIGPNCLGVINLHNHLNASFSKEFSNMGNIAFISQSGAIMTALLDIANYYNLGFS
KIVSMGNKIDVQEYELLNYLENDPHTKVVALYIEGLKDEKFISAAKKISRKKPVIVLKSG
KSEEGAKAASSHTGSLAGNNAVYDAAFKKSRVFNVESFEDLVNLLKIFSVQPPMKSKKLA
VITNAGGFGVLAADSVEKCGLELADFSATTISELKKYLPDTSGISNPLDLIGDADVNRYK
HAFELVENDPNVDGLLAILTPQGMTDALGVARELVKLKNYMICKKDKIPIVASFVGGTSV
LEARSYLQEKGIPSFICPELAVHALACLYRQSHLMDKYDSPEYLNEIRSEIAEAKANNPE
KIDELLANANESNSKEFLKLNGFAIPEKFVATTKEEAKEYAENLGKVVMKVVSADILHKS
DAGCVIIDPSDASEAFETIMKNGEKYLFDRKIDGIIDGVLIEQFVTGKEIIIGAKRDPVF
GPVVMTGLGGIFVEVLKDVSFGITPITKEYAGEILHSLKSYKILEGVRGENRSDIEFLKE
LIVRVGVLMETYDEISEIDINPAFIKEEGQGGFVGDALIITK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcttgagggaatattcaacccaaaatcagttgcagtaattggtgcatcagaa
atcgaaggaaaagttggacagtcagtaatgaaaaacctgttgaatttcaaacagcacggc
ggaaaagtatacccgattaacaaaaaatacaatgaagtatacgggattaaatgttacggt
tctgttttagacgttcctgaaacaccagaccttgtaattatatcaattcctgcagaatat
gcagtagatgccatggaagaatgtggaagaaaaggagtaaaagctgcaataattattact
gcaggatttgcagaaaccaacaaccacgttttagaagacagattaaaagcaattatcgat
cagtacggaatcagaacaatcggtccaaactgtcttggtgtgataaatcttcataaccac
ttaaacgcatcattcagtaaagaattttcaaacatgggtaatatcgcatttatatcacaa
agtggagcgattatgactgcactgctcgatattgcaaattattacaacctcggattttca
aaaatcgtgagtatgggtaacaaaatcgatgttcaagagtatgaattattaaattacctt
gaaaatgaccctcacacaaaagttgtggcactttatattgaaggtttaaaggacgaaaaa
ttcattagtgctgctaaaaaaatctcaaggaaaaaaccagtaattgttttaaaaagtgga
aaatccgaagaaggtgcaaaagctgcgtcttcacacacaggaagccttgcaggaaacaac
gcagtatatgatgcagctttcaaaaaaagtcgtgtatttaatgtagaaagctttgaagac
ctcgtaaatttattaaagatcttttcagtacagccaccaatgaaatccaaaaaacttgca
gttatcacaaatgcaggtggatttggtgttttggcagcagattctgttgaaaaatgtggg
cttgaacttgcagacttttcagcgacaaccatttctgaattgaaaaaatatttaccagat
acatcaggtatttcaaatccactggatttaatcggggatgcggacgttaatagatacaaa
cacgcatttgaattagttgaaaatgatccaaacgtagatggattactcgcaatattaacc
ccacaaggaatgacagatgcacttggtgttgcaagagaacttgtaaaacttaagaattac
atgatatgtaaaaaagataaaattccaattgttgcttcatttgttggaggaacttcagta
ttggaagcaagaagctacttacaagaaaaaggaattccttcattcatctgcccagagctt
gcagttcatgcattagcttgtttatacagacagagccatctcatggacaaatacgacagc
cctgaatacttaaatgaaatcagaagtgaaattgcagaagctaaagctaacaaccctgaa
aaaattgatgaactgcttgcaaatgcaaatgaaagcaactcaaaagaatttttaaaattg
aatggatttgcaattcctgaaaaatttgttgctacaactaaagaagaagctaaagaatac
gctgaaaatttaggaaaagtagtaatgaaagttgtttccgcagatatattacacaaatca
gatgcaggttgtgttataatcgatccaagtgatgcatctgaagcatttgaaacgataatg
aaaaatggggaaaaatatttgttcgataggaaaatcgatggaattatcgatggtgttttg
atcgaacagtttgtcaccggaaaagaaattattattggtgctaaaagagaccctgtattt
ggacctgttgttatgaccgggcttggtggaatattcgtagaagttttaaaggatgtttcc
tttggaattaccccgataacaaaagaatacgcgggagaaatacttcactccctaaaatca
tataaaatcttagaaggcgttaggggcgaaaatagaagtgatatcgaattcttaaaagaa
ttgatcgttagagttggcgttttaatggaaacctacgatgaaataagtgaaatcgatatc
aaccctgcatttatcaaagaagaaggccaaggcggattcgttggagatgcattaattata
acaaaataa

DBGET integrated database retrieval system