KEGG   Methanococcus maripaludis S2: MMP0293Help
Entry
MMP0293           CDS       T00164                                 

Definition
aldolase
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP0293
   01230 Biosynthesis of amino acids
    MMP0293
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0293
   00030 Pentose phosphate pathway
    MMP0293
   00051 Fructose and mannose metabolism
    MMP0293
  Energy metabolism
   00680 Methane metabolism
    MMP0293
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMP0293
Enzymes [BR:mmp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MMP0293
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MMP0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(293196..294122)
Genome map
AA seq 308 aa AA seqDB search
MVKKITFEDVLIPMETPESMHDEYVQNYLKLTRNTGNLMLFAGDQKIEHLNNDFYGENIS
KDDADPEHLFKIAKNSKIGGFAVQFGLLSRYGQNYKDINYIVKLNSKTNLVDVDQKDPLS
RALLDINDILEFKKNSGVNIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGLVVILWIY
PRGKAVQNEKDPKLIAGATGVASCLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLSDAVAMCNAIYAVTIDGKTVSEAL
NIYSERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataacctttgaagatgtattaattccgatggaaactccagaatcaatg
catgacgaatatgttcaaaattacctgaaacttacaagaaatactggcaatttaatgctt
tttgcaggcgatcaaaaaatcgaacacctaaataacgatttttacggggaaaatatttca
aaagacgatgcagatccagaacacctgtttaaaattgctaaaaattcaaaaataggtggt
tttgcagttcagtttggattgttatcgagatacggtcagaactataaagatataaattac
attgtaaaattaaattcgaaaacaaatcttgtggatgtggaccaaaaagacccgttaagt
cgtgcattgttggatattaacgacatattggaatttaagaaaaattcaggagttaatatc
gttggagtaggatatacaatatatcttggaagtgaatacgaatcagagatgctttctgaa
gcttcgaaaataatttatgaagcacataaaggaggacttgttgtaattctgtggatttat
ccaagaggaaaagcggtgcagaatgaaaaagaccctaaactaattgctggagctactggt
gttgcatcatgcttgggtgcagattttgtaaaagtaaactaccctaaatcggaaaatcct
gcagaatcatttaaagaagctgttatggctgctggaagaactaaagttgtatgtgcagga
ggatcaagtaccgatattgaatcatttttaaaacaactttacgaacaaattcacataagt
ggggcgtcaggaaatgcgacaggtcgaaatatccatcaaaaatcgttatctgatgcagtt
gcaatgtgcaatgcaatttatgcagtaacaattgacggaaaaactgtttcagaagcttta
aatatatacagcgaaagaaaatcttaa

DBGET integrated database retrieval system