KEGG   Methanococcus maripaludis S2: MMP0293Help
Entry
MMP0293           CDS       T00164                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp00030  Pentose phosphate pathway
mmp00051  Fructose and mannose metabolism
mmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmp00680  Methane metabolism
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
mmp01230  Biosynthesis of amino acids
Module
mmp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0293
   00030 Pentose phosphate pathway
    MMP0293
   00051 Fructose and mannose metabolism
    MMP0293
  Energy metabolism
   00680 Methane metabolism
    MMP0293
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMP0293
Enzymes [BR:mmp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MMP0293
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MMP0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: CAF29849
UniProt: Q6M0H7
Position
complement(293196..294122)
Genome map
AA seq 308 aa AA seqDB search
MVKKITFEDVLIPMETPESMHDEYVQNYLKLTRNTGNLMLFAGDQKIEHLNNDFYGENIS
KDDADPEHLFKIAKNSKIGGFAVQFGLLSRYGQNYKDINYIVKLNSKTNLVDVDQKDPLS
RALLDINDILEFKKNSGVNIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGLVVILWIY
PRGKAVQNEKDPKLIAGATGVASCLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLSDAVAMCNAIYAVTIDGKTVSEAL
NIYSERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataacctttgaagatgtattaattccgatggaaactccagaatcaatg
catgacgaatatgttcaaaattacctgaaacttacaagaaatactggcaatttaatgctt
tttgcaggcgatcaaaaaatcgaacacctaaataacgatttttacggggaaaatatttca
aaagacgatgcagatccagaacacctgtttaaaattgctaaaaattcaaaaataggtggt
tttgcagttcagtttggattgttatcgagatacggtcagaactataaagatataaattac
attgtaaaattaaattcgaaaacaaatcttgtggatgtggaccaaaaagacccgttaagt
cgtgcattgttggatattaacgacatattggaatttaagaaaaattcaggagttaatatc
gttggagtaggatatacaatatatcttggaagtgaatacgaatcagagatgctttctgaa
gcttcgaaaataatttatgaagcacataaaggaggacttgttgtaattctgtggatttat
ccaagaggaaaagcggtgcagaatgaaaaagaccctaaactaattgctggagctactggt
gttgcatcatgcttgggtgcagattttgtaaaagtaaactaccctaaatcggaaaatcct
gcagaatcatttaaagaagctgttatggctgctggaagaactaaagttgtatgtgcagga
ggatcaagtaccgatattgaatcatttttaaaacaactttacgaacaaattcacataagt
ggggcgtcaggaaatgcgacaggtcgaaatatccatcaaaaatcgttatctgatgcagtt
gcaatgtgcaatgcaatttatgcagtaacaattgacggaaaaactgtttcagaagcttta
aatatatacagcgaaagaaaatcttaa

DBGET integrated database retrieval system