KEGG   Methanococcus maripaludis S2: MMP0317Help
Entry
MMP0317           CDS       T00164                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP0317
   01230 Biosynthesis of amino acids
    MMP0317
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0317
   00030 Pentose phosphate pathway
    MMP0317
   00051 Fructose and mannose metabolism
    MMP0317
  Energy metabolism
   00680 Methane metabolism
    MMP0317
Enzymes [BR:mmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MMP0317
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MMP0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312964..314115
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDETLIDYYVTNCGDDIDMIMT
HNKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSTSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYRMFSDPFSTAGLVYDPSMTTGFRYEVLDVMEHKRVF
MDSPEETYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFLEMDEGCECKLDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaaccttaagtgttattaaggcagatgttggagggctttgtggacac
acattagctcctgaggaattattggacgctgcagagtatgttctcgaaaatgcactcgat
gaaacattaattgattattatgttacaaactgtggtgatgatattgatatgatcatgacc
cacaacaaaggaacagacaacgaagaagtgcacaaactcgcatgggatgctcttgaagca
gcaacagaagttgcaaaagagttaaaattatacggtgcaggtcaagacttactttcaact
tcattttctggaaacgttaaaggactcggtccaggttgcgcagaaatggaatttgttgaa
agaccaagtgaaccagttgtagtattctgctgtgacaaaaccgaccctgcagcattcaat
ttaccattctacagaatgttttcagacccattcagcactgcaggtttagtatacgaccct
tcaatgaccacaggattcaggtacgaagttttagatgttatggaacacaaaagagttttc
atggactcccctgaagaaacctattcattacttgcattaattggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaatgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgctggagaatatgttggaaaagacgatccagtagcaattgtaaga
gctcaaagcggattccctgcagtaggggaagttttagaaggatttgcaaacccacactta
gttgcaggatggatgagaggatgccattttggacctatcatgcctgttgctgaagaagac
gcaatgcctgcaagatttgatggccctgcaagagttatggctttaggattccagttatcc
cacggaagattggttggaccaaacgacctcttcgcagacaaatcattcgataaagcaaga
gaaaaagcactcgacatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttacctgaatcaatgatggaatacacatcagttccaaaagttttagctcagttaaaagac
agattcctcgaaatggacgaaggatgcgaatgcaaactcgacgaaataagagaaagagga
gacatggaataa

DBGET integrated database retrieval system