KEGG   Methanococcus maripaludis S2: MMP0325Help
Entry
MMP0325           CDS       T00164                                 

Definition
(GenBank) Glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
mmp01230  Biosynthesis of amino acids
Module
mmp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0325
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MMP0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C TrkA_N NAD_binding_3 CoA_binding Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CAF29881
UniProt: Q6M0E6
Position
complement(321169..322191)
Genome map
AA seq 340 aa AA seqDB search
MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAVEKGYKLFAAIPERKHL
FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDIKTGP
VNAIVPNPVTVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
DALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKALGLIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtattgataaacggttacggctctatcggtaaaagggttgccgatgcagta
gctaaacaggacgatatgaaagttattggagttacaaaaacgaaacctgactttgaagct
aaaatggctgttgaaaagggatacaaattatttgcagcaattcctgaaagaaaacatctt
tttgaagaagcaggaattcctgttgaaggaacacttgacgatattattgaagatgcagat
attgtagttgacggagcccctaaaaaaattggaaaagcaaatctcgaaaacgtatacaaa
aaacacggcgtaaaagcaataatccaaggtggagaaaaagcaggcgacgcacaagactca
tttaactcactatggagttacgacagatgctacggaaaagactacatcaggctcgtatcg
tgcaacacgacaggactttgtagatcaatgtacgcaattaattcagttgcagacatttta
aaagcaagaatcgtactcataagaagagctgctgatcctaacgacataaaaacaggacct
gtgaacgcaatcgttccaaatccagtaactgtgccatcacaccacggaccagacgttgtt
tcagttattcccgaactcgatggaaaaatcatgacttcagcagttatcgttccaacaacc
ttgatgcacatgcactcaataatggtagaaacttctggaacgaatagagatgaaataata
gatgcacttgcaaaaacaccaagaatattaaccgtaaaagcttcagaaggatttgattca
actgcaaaaattattgaatatgcaagagaccttggaagaagcagatacgatctaaatgaa
attgcagtatgggaagaaagcgtaaacgttgtagacaatgaagtatacatgatgcaggca
atacaccaggaaagcgatgttatccctgaaaacgtggactgtatccgagcaatgctcgaa
atggaaagcgacaacttaaaatcaattgaaaaaaccaataaagcgctaggtttaattaaa
taa

DBGET integrated database retrieval system