KEGG   Methanococcus maripaludis S2: MMP0327Help
Entry
MMP0327           CDS       T00164                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324525..326042
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGENAVIVNEDDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVQKGE
VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEIGEMTKRIAETGDMISWEKNLVVDIHSIGGVPGNKYALLS
IPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELKEDEIKRIVKTTNGCLVWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYSVIDIPVGKGVKIKNEAEGAKL
ARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAKEAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQNLAWEILESGRALEKFNQIIIEQGGTPKKPEEIELGDYIEEII
APIDGYVTDINNTGITNVVKEAGAPRDKKAGLLLNSKIGNKVKKGDVLYTIYSGSEERLV
SAVNLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaatgcaaaatttatagaccttgatctgggcgaaaatgcggtaattgtt
aacgaagacgatttaaaaggaacttcttactacccgcaggatagggtattgatagagtca
cacgcaggttctgtcattggaaatatttattctacaaaaacaatggtccaaaaaggcgaa
gttggaatgcttgtcagtgaacttgcagaaatttcaatttcagaaggggaagaagtaaaa
ttaaggcatgcagaaaagcctgaatcgattccgtttataaaaaagaaaatggatggtcag
gttttaaatccgcatgaaataagaacgataattgatgaaatcgtatctaaaaaactttca
aacattgaattatccgcatttgtttcatctacgtatattaatggaatgaatatggatgaa
ataggcgagatgaccaagagaattgcagaaacaggggacatgatttcttgggagaaaaat
cttgttgttgatatccacagtattggtggagttcctgggaataaatacgctctgctttca
attccaatacttgcagcagcgggaatcacaattccaaaaacctcatcaagggcgataact
tcgcctgcaggaactgccgatgtaatggaagtgctcacaaatgttgaattaaaggaagac
gagataaaaagaatagtaaaaaccacaaacggatgtcttgtatggggtggaggagtaaat
ttggctcctgctgacgatatcatcatcaatgtggaaagaccagtttcaatagaccctcag
ccacagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatactctgta
atcgatattccagttggaaaaggcgtaaaaattaaaaatgaggcagaaggtgcaaaatta
gcgaggaaatttattgaacttggggaattgttaaatattaaagtagaatgtgtcttaacg
tatggtggacagcctcttggacgggcaattggacctgcactcgaagcaaaagaagcaatc
gaagcacttcaagatcccaaaaatgctccaaaaagtttaattgaaaaagccttatctctt
gcaggaattcttcttgaacttgggggagctgcacaaattggtgaagggcagaacttagcc
tgggaaattttagagtctggtagggcacttgaaaaattcaaccagatcataattgaacag
ggcggaactccaaaaaaacctgaagaaatagaacttggagactatattgaagaaataatt
gctccaatagatggctacgttacagatataaataatactggaattacaaacgtagttaaa
gaggctggagctccaagggataaaaaagcaggacttttactaaactcaaagattggaaac
aaagttaaaaaaggagatgtgttgtataccatctattctggctctgaagaaaggcttgta
tcagcagtaaatcttgcgagaagagtttatcctgtaaaagttgaaggaatgcttattgaa
agaataagtaaattctaa

DBGET integrated database retrieval system