KEGG   Methanococcus maripaludis S2: MMP0341Help
Entry
MMP0341           CDS       T00164                                 

Gene name
pycA
Definition
pyruvate carboxylase subunit A (EC:6.4.1.1)
Orthology
K01959  
pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP0341 (pycA)
   01230 Biosynthesis of amino acids
    MMP0341 (pycA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMP0341 (pycA)
   00620 Pyruvate metabolism
    MMP0341 (pycA)
Enzymes [BR:mmp01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MMP0341 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337634..339139
Genome map
AA seq 501 aa AA seqDB search
MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSY
LNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEFIGPPTNAIDVMGSKINAK
KAMKTAGVPVLPGREESIESEEEAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELVDT
IQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIE
ESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEFLYSKGEFYFLEMNTRVQVEHPITE
VVTGVDIVKEQIKIAAGKKLSYTQDEITFRGHAIECRVNAEDAINDFVPAPGKIKYYRSP
GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYMVLGIITNIPF
HRAVIEEDNFLKGNLSTHYVEDNLCSFRKAMVNYALEAKDREKIFSEKVFHGNKKVIAIA
GGLNAYITSLSNKNKDKYDKN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtattgatagccaataggggagaaattgcagtcagggtaattcgagca
tgtaaagaacttggaattaagactgttgcagttttttctgaagctgacgaacactcactc
tatagaaatattgcagatgaatgttatccaatcggggaacctcctgcatcaaaaagctac
cttaacatggaaaggatcttaaaagtggctgaaaaagcaggtgtggatgcagttcaccca
ggatatggttttttatctgaaaatgtaaaatttgcagatgaatgtcacaaaagaggcatt
gaatttatcggccctccaacaaacgcaattgatgttatgggcagtaaaatcaatgctaag
aaagcaatgaaaacagcaggagttcctgtactgcctggaagggaagaatcaatcgaaagc
gaagaagaagcaatcgaagttgcagatgaaattggataccctgtaatcataaaagcatct
gcaggtggtggcggtatcggaatgaacgtggtttacaataaagaagaactcgttgatacg
atacagtctacaaaatccattgcacagagtgcttttggtgattcaacagtatttattgaa
aaatacctcgaaaaaccaagacacattgaaatacaggtggttgcagataaatttggaaat
gtgattcaccttggtgatagggagtgttcaattcaaagaaggcaccaaaaattaattgaa
gagtccccctctccaatcatgaccgaggaattaagggaaagaatgggaaatgcagctgta
aaagctgctaaggccataaattaccacagcgtgggtacggttgaatttttatacagcaaa
ggcgaattttatttccttgaaatgaatacaagagttcaggtagaacacccaataacagag
gttgttactggcgttgatatcgtaaaagaacagataaaaattgcagccggaaaaaaatta
tcctacacccaagatgaaattacattcagaggacatgcaatagaatgtagggtaaatgca
gaagatgcaataaatgattttgttccagctcctggaaaaataaaatattaccggtctcct
ggaggtccaggtgtaaggctcgatagtggtgtatttgggggagctgaaattccaccttat
tatgattccatggttgcaaagataattacgtacggtcttacaagagaagaagcaattgaa
aggatgaaaagggcactttccgaatatatggttctaggaataattacaaacatacctttc
cacagggcggtaattgaggaagacaactttttaaaaggaaacctttcaacgcactacgtt
gaagataatctatgctcatttagaaaagcaatggtaaattatgctttagaagcaaaagat
agggaaaaaatattcagtgaaaaagtattccatggtaataaaaaggtcattgcaattgca
ggcggtttaaatgcttacataacaagcctttcaaataaaaataaggataaatacgataaa
aattaa

DBGET integrated database retrieval system