KEGG   Methanococcus maripaludis S2: MMP0341Help
Entry
MMP0341           CDS       T00164                                 

Gene name
pycA
Definition
pyruvate carboxylase subunit A (EC:6.4.1.1)
Orthology
K01959  
pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mmp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmp01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmp00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337634..339139
Genome map
AA seq 501 aa AA seqDB search
MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSY
LNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEFIGPPTNAIDVMGSKINAK
KAMKTAGVPVLPGREESIESEEEAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELVDT
IQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIE
ESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEFLYSKGEFYFLEMNTRVQVEHPITE
VVTGVDIVKEQIKIAAGKKLSYTQDEITFRGHAIECRVNAEDAINDFVPAPGKIKYYRSP
GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYMVLGIITNIPF
HRAVIEEDNFLKGNLSTHYVEDNLCSFRKAMVNYALEAKDREKIFSEKVFHGNKKVIAIA
GGLNAYITSLSNKNKDKYDKN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtattgatagccaataggggagaaattgcagtcagggtaattcgagca
tgtaaagaacttggaattaagactgttgcagttttttctgaagctgacgaacactcactc
tatagaaatattgcagatgaatgttatccaatcggggaacctcctgcatcaaaaagctac
cttaacatggaaaggatcttaaaagtggctgaaaaagcaggtgtggatgcagttcaccca
ggatatggttttttatctgaaaatgtaaaatttgcagatgaatgtcacaaaagaggcatt
gaatttatcggccctccaacaaacgcaattgatgttatgggcagtaaaatcaatgctaag
aaagcaatgaaaacagcaggagttcctgtactgcctggaagggaagaatcaatcgaaagc
gaagaagaagcaatcgaagttgcagatgaaattggataccctgtaatcataaaagcatct
gcaggtggtggcggtatcggaatgaacgtggtttacaataaagaagaactcgttgatacg
atacagtctacaaaatccattgcacagagtgcttttggtgattcaacagtatttattgaa
aaatacctcgaaaaaccaagacacattgaaatacaggtggttgcagataaatttggaaat
gtgattcaccttggtgatagggagtgttcaattcaaagaaggcaccaaaaattaattgaa
gagtccccctctccaatcatgaccgaggaattaagggaaagaatgggaaatgcagctgta
aaagctgctaaggccataaattaccacagcgtgggtacggttgaatttttatacagcaaa
ggcgaattttatttccttgaaatgaatacaagagttcaggtagaacacccaataacagag
gttgttactggcgttgatatcgtaaaagaacagataaaaattgcagccggaaaaaaatta
tcctacacccaagatgaaattacattcagaggacatgcaatagaatgtagggtaaatgca
gaagatgcaataaatgattttgttccagctcctggaaaaataaaatattaccggtctcct
ggaggtccaggtgtaaggctcgatagtggtgtatttgggggagctgaaattccaccttat
tatgattccatggttgcaaagataattacgtacggtcttacaagagaagaagcaattgaa
aggatgaaaagggcactttccgaatatatggttctaggaataattacaaacatacctttc
cacagggcggtaattgaggaagacaactttttaaaaggaaacctttcaacgcactacgtt
gaagataatctatgctcatttagaaaagcaatggtaaattatgctttagaagcaaaagat
agggaaaaaatattcagtgaaaaagtattccatggtaataaaaaggtcattgcaattgca
ggcggtttaaatgcttacataacaagcctttcaaataaaaataaggataaatacgataaa
aattaa

DBGET integrated database retrieval system