KEGG   Methanococcus maripaludis S2: MMP0418Help
Entry
MMP0418           CDS       T00164                                 

Definition
carbohydrate kinase PfkB (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MMP0418
Enzymes [BR:mmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MMP0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419415..420323
Genome map
AA seq 302 aa AA seqDB search
MDKIGKITAVGHIALDYIFNVDKFPELNTSMQIPTAKKYYGGAACNVAAEIANLGVKSEI
LSCVGTDFKASGYGEYLEKLGVSTKNVYVSEEEETPKAWIFTDPQNNQITYFLWGAAKHY
PEIEVPEFDSEIVHLATGDPNYNLKCAQKASSKGIFVSFDPGQDLTLYSKENMENIIENV
DFLFMNNHEFQRTLDLLNISEKELISRVKVLIVTYGKQGSIIYSEDEAIKVPAILTQAKD
PTGAGDSYRAGFLTAYLKGHDLKNCGLAGSCVASFVVEQVGCQTNLPSWEMVIERLNENN
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaattggtaaaataacagcggtaggccatattgcacttgattacatattcaat
gtggataaatttccagaattaaacacttcaatgcagattccaactgctaaaaaatactat
ggcggtgctgcatgcaatgttgcagcagaaattgcaaatttaggcgtaaaatcagaaata
ctttcatgtgtcggaactgactttaaagcttcaggatatggggaatatttagaaaaattg
ggcgtttcaactaaaaatgtatatgtttcagaggaagaagaaactccaaaggcatggatt
tttactgatcctcaaaacaaccagataacgtactttttatggggtgctgcaaaacactac
cctgaaattgaagttccagaatttgattcagaaattgtacaccttgcaactggggacccc
aattacaatttaaaatgtgcacaaaaagcaagttcaaaaggaattttcgtatcattcgat
ccgggacaggatttaacattatattctaaagaaaacatggaaaacatcatcgaaaacgtt
gattttttatttatgaacaaccacgaattccagagaacccttgatttattgaatatttct
gaaaaagagctgattagtcgagttaaagttttaattgtaacttacggaaaacagggaagc
atcatatattcagaagatgaagcaatcaaagttcctgcgatattaacccaagcaaaagac
ccaactggtgcgggagacagctaccgggctggatttttaactgcgtatttaaaagggcac
gatttaaagaactgtggacttgcaggttcatgtgtggcttcttttgttgtggaacaggta
ggctgtcaaaccaaccttccttcatgggaaatggttattgaacgacttaacgaaaataac
cttctataa

DBGET integrated database retrieval system