KEGG   Methanococcus maripaludis S2: MMP0553Help
Entry
MMP0553           CDS       T00164                                 

Gene name
argF
Definition
ornithine carbamoyltransferase (EC:2.1.3.3)
Orthology
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MMP0553 (argF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MMP0553 (argF)
Enzymes [BR:mmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     MMP0553 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(556641..557555)
Genome map
AA seq 304 aa AA seqDB search
MDLLTLWNLEREEVLKIIEDAEYFKKNRYGHEILKNKSIALIFESPSTRTRMSFDLAVNE
LGGHSLMMNEGEIHLGKKESIADTARVMSRFVDAIVARVKNHKTLEDLAEYGSVPVINAL
CDLAHPCQILADLLTMKENGKNFKGLKLAYFGDGNNVSNSLMIAGAILGMDVVIATPRSY
EPNGLFVKKALEIIAKYGEGSLTLTDDPEIAAKDADVLYTDVWISMSDKNKQMDEILKIF
PKFQINDEILSKAKKDAIVLHCLPANRGLEITDEVIDGKQSKVFDQAENRLHAQKAVLKY
IFEH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatttattaacactctggaatttagagcgagaagaagttttaaaaattattgaagat
gctgaatactttaagaaaaatagatacgggcatgaaatactcaaaaataagagtatcgca
ttgatttttgaaagcccgtctacaagaaccagaatgagttttgaccttgcagtaaatgaa
cttggcgggcactccttgatgatgaatgaaggggaaatccaccttgggaaaaaagaaagc
attgctgatactgcacgagttatgagcagatttgttgatgcaatcgttgcaagagttaaa
aatcacaaaacactggaagatcttgcagaatacgggagtgttccagtaattaatgcactc
tgcgaccttgcacacccttgccagatattagcagatttacttacaatgaaagaaaacggc
aaaaacttcaaaggattaaaattagcatactttggtgatggaaacaacgtatcaaactca
ttaatgattgctggagcaattttgggaatggatgttgttattgcaacccctagaagttat
gagccaaacggacttttcgttaaaaaagcgcttgaaataatcgcaaaatacggggaagga
agtttaacattaaccgatgacccagaaattgctgcaaaagatgccgatgttttatatact
gacgtatggatcagcatgagtgacaaaaataaacagatggatgaaatattaaaaatattc
ccaaaattccagataaatgatgaaattttatcaaaagcaaaaaaagatgcaatagtactc
cactgccttcctgcaaacaggggattagaaattacagatgaagtaatcgatggaaaacaa
tcaaaagtatttgatcaggctgaaaacaggcttcacgctcaaaaagcagtattaaaatac
atttttgaacattaa

DBGET integrated database retrieval system