KEGG   Methanococcus maripaludis S2: MMP0687Help
Entry
MMP0687           CDS       T00164                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP0687 (tpiA)
   01230 Biosynthesis of amino acids
    MMP0687 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0687 (tpiA)
   00051 Fructose and mannose metabolism
    MMP0687 (tpiA)
   00562 Inositol phosphate metabolism
    MMP0687 (tpiA)
Enzymes [BR:mmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MMP0687 (tpiA)
Exosome [BR:mmp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MMP0687 (tpiA)
  Exosomal proteins of bladder cancer cells
   MMP0687 (tpiA)
  Exosomal proteins of melanoma cells
   MMP0687 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675181..675702
Genome map
AA seq 173 aa AA seqDB search
MILDEVNIPVYAQHMDAVTPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI
SNKLGLKTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE
INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKNVEDAIRELIAEI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaagtaaatattcctgtttatgcgcaacacatggatgcagtaactcct
ggaagcagtactggacatatattgcctgatgcattaaaagatgcaggagttacaggaact
cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcattgaaatt
tcaaataagctcggattaaaaacggttgtatgcacaaacaacatacctgtttcaaaagca
gtttctgcgttaaatccaacttcaattgcagtagaacctccagaattgattggaagcgga
atacccgtttcaaaagcaaatcctgaagtagtatctggaactgttcgagaggttcgagaa
attaataaaaacgttgaaatattgtgtggtgcaggtatatcaaaaggagaagatgtaaaa
tctgcgcttgaacttggaacaaacggtgttttgcttgcatcaggtgttgtaaaagctaaa
aacgtcgaagatgcaataagagaattaattgcagaaatttaa

DBGET integrated database retrieval system