KEGG   Methanococcus maripaludis S2: MMP0702Help
Entry
MMP0702           CDS       T00164                                 

Definition
hypothetical protein
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MMP0702
Enzymes [BR:mmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MMP0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692462..693340
Genome map
AA seq 292 aa AA seqDB search
MRMGIISEERDWVTDELKSKMEKNDIDPVIIQPSKIISYIESEVKFEQNNRSILDLKCAF
VRNIGEGVEMFHRFDMLKYLENYVPIINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAE
DVNKALIAADKFEDVVLKPLFGNQGKGLVRVKGRSTVAKLKALNTFKSTHGVIYMQEFVN
NPNNVYRDIRAFVVGDKVISAMYRTSDNWITNIHQNGVPEKCEITEELSKIVLAAKDAVG
LVYAGVDILESSDGLKVIEVNACPSWEGLSRISEVDIAQNLIDEALNYAKEY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgggaataatctctgaagaaagggactgggtaaccgatgagttgaagtccaaa
atggaaaaaaatgacatcgacccagttattatacagccctcaaaaataatttcttatatc
gaatcggaagttaagtttgaacagaataatcggagtatacttgacttaaaatgcgcgttt
gttagaaacatcggtgaaggagtcgaaatgtttcacaggtttgacatgttaaaatacctt
gaaaattacgtacccataataaacccgatggatggaattgaaaatgcaggaaataaattc
aggacatcatttttaatggaagttcacaaaattcctcatccaaaaacaatcgttgcagaa
gatgtaaataaagcgttaatcgcagcagataaatttgaagatgttgttttaaaacctctt
tttggaaatcaaggaaaaggccttgtaagggttaagggtagatcaaccgttgcaaaatta
aaagcgttaaatacttttaaaagcactcacggcgtaatttatatgcaagaatttgtaaac
aatccaaataacgtttatagggacattcgagcatttgtagttggggataaggtaatttct
gcaatgtatagaacgtctgacaactggattacaaatattcaccagaatggtgttccagaa
aagtgcgaaataactgaagaattaagtaaaattgtgcttgctgcaaaagatgcagtaggg
ctcgtttatgccggtgtagatatactcgaaagcagtgatgggttaaaagttatcgaagta
aatgcatgtccttcatgggaaggactttcaagaatttctgaagtagatatcgctcaaaac
ttaattgatgaagctttaaattatgcaaaagagtattaa

DBGET integrated database retrieval system