KEGG   Methanococcus maripaludis S2: MMP0802Help
Entry
MMP0802           CDS       T00164                                 

Definition
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp00071  Fatty acid degradation
mmp00350  Tyrosine metabolism
mmp00625  Chloroalkane and chloroalkene degradation
mmp00626  Naphthalene degradation
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0802
  Lipid metabolism
   00071 Fatty acid degradation
    MMP0802
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMP0802
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMP0802
   00626 Naphthalene degradation
    MMP0802
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMP0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAF30358
UniProt: Q6LZ27
Position
794946..796115
Genome map
AA seq 389 aa AA seqDB search
MSFNMYVPTKVLFGAGQLNNLHEQKMPGKKAMIVISNGKSTREYGYLARTEEQLKLAGVE
TVVFDKVEPNPLRSTVMAGGAFAKENDCDFIVALGGGSCIDASKAMSIMATNDGDYWDYI
FGGTGKGMPLKAKPIPVVAITTTAGTGSETDPWAVVTHEINREKIGFGNEDTFPVLAVVD
PELMKSVPPKYTAYQGFDALFHSVEGYVSIGANLMSDMYAITAIENVSKNLSKAVEDGND
MDAREKVAFGNTLSGVVETVGLCTSQHALEHAMSAYHQDLPHGAGLIMISKAYFTHFIEK
HVCDDRFVKMAKVMGMEDATEPMDFIRMLVKLQEECGVSDLKMSDYGITPEEFEKMAKNA
VDTMGMLFTCDRAQLSIEDCVSIYSASYK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaacatgtatgtgccaacaaaagtcttgtttggagcaggacaactaaataat
ttacacgaacaaaaaatgcctggcaaaaaagctatgattgttatttcaaatggaaaatct
acaagggaatacggttaccttgcaagaactgaagaacagttaaaattagcaggtgtagaa
actgtagtatttgataaagttgaaccaaacccattaagatcaaccgttatggctggcggt
gcttttgcaaaagaaaatgactgcgatttcattgttgcattaggtggcgggagctgtatc
gatgcatcaaaagcaatgtccataatggctacaaatgatggagattactgggattacatt
tttggcggaactggaaaaggaatgcctttgaaagctaaaccaatccctgttgtagcaatt
acaactacagcaggaacaggttctgaaaccgatccttgggcagttgtaacacatgaaata
aatcgtgaaaaaatcggatttggtaacgaagatacgtttccagttttagcagtagttgat
cctgaacttatgaaatcagtacctccaaaatacacggcatatcaaggatttgatgcatta
ttccacagcgtggaaggttatgtatctatcggcgcaaatctcatgagcgacatgtatgca
atcacggcaatagaaaatgtttcaaaaaatctctcaaaagctgttgaagatggaaatgat
atggatgcacgtgaaaaggttgcttttggaaatacgttatcaggggtagttgaaactgtt
ggactttgtacaagccagcacgcattagaacacgcaatgtctgcttatcaccaagatctt
cctcacggtgcagggcttataatgatcagcaaagcatactttactcattttatcgaaaaa
catgtatgtgatgacaggtttgtaaaaatggcgaaagtaatgggtatggaagatgcaaca
gaacctatggatttcatcagaatgctcgtaaaattacaagaagaatgtggagtttcagat
cttaaaatgtctgattatggcattactcctgaagaatttgaaaaaatggcgaaaaatgca
gtggatacaatgggaatgttgtttacctgtgacagagctcagttaagtatcgaagattgc
gtttcaatttacagcgcatcctataaataa

DBGET integrated database retrieval system