KEGG   Methanococcus maripaludis S2: MMP0802Help
Entry
MMP0802           CDS       T00164                                 

Definition
Iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MMP0802
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0802
  Lipid metabolism
   00071 Fatty acid degradation
    MMP0802
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMP0802
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMP0802
   00626 Naphthalene degradation
    MMP0802
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMP0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794946..796115
Genome map
AA seq 389 aa AA seqDB search
MSFNMYVPTKVLFGAGQLNNLHEQKMPGKKAMIVISNGKSTREYGYLARTEEQLKLAGVE
TVVFDKVEPNPLRSTVMAGGAFAKENDCDFIVALGGGSCIDASKAMSIMATNDGDYWDYI
FGGTGKGMPLKAKPIPVVAITTTAGTGSETDPWAVVTHEINREKIGFGNEDTFPVLAVVD
PELMKSVPPKYTAYQGFDALFHSVEGYVSIGANLMSDMYAITAIENVSKNLSKAVEDGND
MDAREKVAFGNTLSGVVETVGLCTSQHALEHAMSAYHQDLPHGAGLIMISKAYFTHFIEK
HVCDDRFVKMAKVMGMEDATEPMDFIRMLVKLQEECGVSDLKMSDYGITPEEFEKMAKNA
VDTMGMLFTCDRAQLSIEDCVSIYSASYK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaacatgtatgtgccaacaaaagtcttgtttggagcaggacaactaaataat
ttacacgaacaaaaaatgcctggcaaaaaagctatgattgttatttcaaatggaaaatct
acaagggaatacggttaccttgcaagaactgaagaacagttaaaattagcaggtgtagaa
actgtagtatttgataaagttgaaccaaacccattaagatcaaccgttatggctggcggt
gcttttgcaaaagaaaatgactgcgatttcattgttgcattaggtggcgggagctgtatc
gatgcatcaaaagcaatgtccataatggctacaaatgatggagattactgggattacatt
tttggcggaactggaaaaggaatgcctttgaaagctaaaccaatccctgttgtagcaatt
acaactacagcaggaacaggttctgaaaccgatccttgggcagttgtaacacatgaaata
aatcgtgaaaaaatcggatttggtaacgaagatacgtttccagttttagcagtagttgat
cctgaacttatgaaatcagtacctccaaaatacacggcatatcaaggatttgatgcatta
ttccacagcgtggaaggttatgtatctatcggcgcaaatctcatgagcgacatgtatgca
atcacggcaatagaaaatgtttcaaaaaatctctcaaaagctgttgaagatggaaatgat
atggatgcacgtgaaaaggttgcttttggaaatacgttatcaggggtagttgaaactgtt
ggactttgtacaagccagcacgcattagaacacgcaatgtctgcttatcaccaagatctt
cctcacggtgcagggcttataatgatcagcaaagcatactttactcattttatcgaaaaa
catgtatgtgatgacaggtttgtaaaaatggcgaaagtaatgggtatggaagatgcaaca
gaacctatggatttcatcagaatgctcgtaaaattacaagaagaatgtggagtttcagat
cttaaaatgtctgattatggcattactcctgaagaatttgaaaaaatggcgaaaaatgca
gtggatacaatgggaatgttgtttacctgtgacagagctcagttaagtatcgaagattgc
gtttcaatttacagcgcatcctataaataa

DBGET integrated database retrieval system