KEGG   Methanococcus maripaludis S2: MMP0968Help
Entry
MMP0968           CDS       T00164                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mmp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954600..955874
Genome map
AA seq 424 aa AA seqDB search
MIVKKISKLNEKELDIILNRNKTNISGILPTVSEILENVQKNGDNALKEYTKKFDGVDID
NFKVSTEEIDKAYDKIDSKVVESLEKAYENIREFHEIQFKNLNEWEIDKKGIKAGQIIRP
VEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKEVIVTSPPNGTEGNPATLVASDIAKADG
IYKIGGAQAIGALAYGTKSIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCIITVTSEKKAEKIKERILMEIKTAKRTEIIEKSIL
NSAIVIGSIDECIELSNSYAPEHLEIMTKNPREVLKSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLLGISDIVTTLAEAEGLFNHSEAVK
RRLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcaaaaaaatatcaaaattaaacgaaaaagaacttgatattatacttaacagg
aataaaacaaacatttctggaattttaccaacagtaagcgaaattttagaaaatgttcaa
aaaaatggagataatgccttaaaagaatatactaaaaaattcgatggcgttgacattgat
aattttaaagtatctactgaagaaattgataaagcatacgacaaaattgattcaaaagta
gttgaatctcttgaaaaagcttatgaaaacattagggagtttcacgaaatccagtttaaa
aatttaaacgaatgggaaattgataaaaaaggaattaaagcgggacaaattataagacct
gttgaaaaagctggatgttacgttccaggaggacgggcattttacccttcaacagtttta
atgactgtaactcctgcaaaagtagcgggtgtaaaagaggtaattgtaacctcccctcca
aacggaaccgaaggaaaccctgcaacacttgttgcttcagacattgcaaaagctgatgga
atatacaaaatcggaggagctcaagcaattggagctcttgcatacggtactaaatctatt
ccaaaagtcgatattattgtagggcctggaaatatctttgtaactgccgctaaaaagtta
gtttacggtgaagtttcaattgattttccagcagggccttccgaagttcttattatgtgt
gatgaatcatcaaatgaagaatacgttgcaatggactttttagcacaggctgagcacgac
cctaacgcttcatgtataattacagtcacttccgaaaaaaaagcggaaaaaattaaagaa
agaattttgatggaaataaaaactgctaaaagaaccgaaattattgaaaaatcgatttta
aattctgcaatcgttatcggctcaattgatgaatgtattgaactttcaaacagctacgca
ccagaacacttggaaataatgacaaaaaatccaagggaagttttaaaatccattgaaaat
gcaggcagcatctttttaggaaattacgcacctgttcctgttggagactatgcaagcggt
actaaccacgttcttccaacatccgcctgtgcaaaaatgtattctggactcagcgttgaa
acatttattaaaaagccaacagtccaagaattgacaaaagaaggacttttaggaattagt
gacattgtaaccacacttgcagaagctgaaggattattcaaccattctgaagcagttaaa
agaagattaaattaa

DBGET integrated database retrieval system