KEGG   Methanococcus maripaludis S2: MMP1002Help
Entry
MMP1002           CDS       T00164                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MMP1002 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMP1002 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMP1002 (trpA)
Enzymes [BR:mmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MMP1002 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(986571..987347)
Genome map
AA seq 258 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRSLSN
NFKIAKSFEVLKEFRKESDTPVILMTYYNPVYKRGIENFVIQAKEAGANGLIIVDLPLQE
ATEYRKICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARDTFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSKEALVKLE
ELAKELSEGIDKGYEKRK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccagtgttagtcagttttttagtttcgggagacccaaatccggatgcaaca
ttgaaatttatgaaaacactcgataaatattcgggagtaatcgaacttggaattccattt
agtgatcctgttgcagatgggccaacaattcaggcagcagatgtaaggtccttatcaaac
aattttaaaattgcaaaatcatttgaagtattgaaagaatttagaaaagagtcagatact
cctgtaattttgatgacttactacaatccagtttacaaaagaggaattgaaaactttgta
attcaggcaaaagaagcaggtgcaaacgggcttattattgttgatttgccacttcaagaa
gcaacagaatatcggaaaatctgtaaaaaacacgaaatgggaacggtatttcttgcagca
ccaaacacccctgaagaacgtttaaaaatatctgatgaagcaagtactgaatttttatac
cttatttcaacttttggaataactggtgcaagagatacctttgaacagatgacttttgat
tttattaaacgagcaagaacaacctgtaagggaaaaatctgcgttggatttggaatttca
aaaggaagtcatgcagaaagtttaattgaacagggtgcagatggagtaattgttggaagt
gcttttgtagatattattaaaaattatggggattcaaaagaagcacttgttaaattagaa
gaactcgcaaaagaattgagtgaaggaatcgataaaggatacgaaaaaagaaaataa

DBGET integrated database retrieval system