KEGG   Methanococcus maripaludis S2: MMP1091Help
Entry
MMP1091           CDS       T00164                                 

Definition
ADP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MMP1091
   00052 Galactose metabolism
    MMP1091
   00500 Starch and sucrose metabolism
    MMP1091
   00520 Amino sugar and nucleotide sugar metabolism
    MMP1091
Enzymes [BR:mmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MMP1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083536..1084384)
Genome map
AA seq 282 aa AA seqDB search
MIKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLANAGIEDILVITGRGKY
AIENHFDKNFELEERLKKDGKCEPLKKILDINEFANIYYTRQGKQNGLGDAVHCGKEFIC
EDYTIVMVGDTIYSGNVPKKLLEAHKKYRCSVIALERVPKEDVYKYGVISGKELENGIFE
INDLVEKPTVEDAPSNLIITGAYLLSSKIFDHLENTQPGRGGEIQLTDAMKSLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIENIDGFKEYIRELCDK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagctatcatacctgcagcaggatttggaacaaggcttctcccaattaca
aaagcacagccaaaagagatgttaccggtacttggaaaaccaattatacagtatgtaatt
gaagatttggcaaatgcgggaattgaggatattttggtaattactggccgtggaaaatac
gcaatagaaaaccacttcgataaaaattttgaactcgaagagcggttaaaaaaagatgga
aaatgcgaacccttaaaaaaaattttagatattaatgaatttgcaaatatatattataca
aggcagggaaaacaaaatggccttggagatgcagtgcattgtggaaaagagtttatttgt
gaagattatacaattgtaatggttggggacaccatttattctggaaatgtaccaaaaaaa
ctccttgaagcacataaaaaatacagatgttctgtaattgcacttgaaagagttccaaaa
gaagatgtttataaatacggagtaatttctggaaaagaacttgaaaatggaatttttgaa
ataaatgatcttgtggaaaagccaactgtagaagatgcgccatccaatttgataatcacg
ggagcttatttattatcttcaaaaatattcgatcaccttgaaaatacacaacctggacga
ggtggggaaattcagctaactgatgccatgaagtctcttttaaaagaagaaaaaataatt
ggggtcgaagttgatttcaaaagatatgatattggagacattaaaggatggcttgaagca
aacgttgaacttggaatagaaaacattgatggatttaaagaatatattcgggaattgtgc
gataaataa

DBGET integrated database retrieval system