KEGG   Methanococcus maripaludis S2: MMP1105Help
Entry
MMP1105           CDS       T00164                                 

Gene name
sucC
Definition
succinate-CoA ligase (ADP-forming), beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mmp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmp00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmp00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mmp00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096371..1097459
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENNIPIPKNKLVSGKVESIDYPVVIKAQVLVGGRGKAGGILFADNVD
DANEKIESLIGNTVKGELVEKVLLEEQIKIVKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLSLNPEKEFLPYLARGMLKKAGIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLVFTEDGKIIAADAVLNVDDDAYFRHNYEKFEEFNKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGNPACFLDVGGGSNRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSMGIVDVLKENPNLKFAVRMMGTNEEEGRRILSENGISFESSMEGAAKALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggaaatttttaaagaaaataatatcccgattcca
aaaaataaacttgtaagcggaaaggttgaaagcatcgactaccctgttgttataaaagcg
caagttttagttggcggaagaggtaaagctggcggaatcttatttgcagataatgtcgat
gatgcaaacgaaaaaattgaatcattaattggaaacacggttaaaggcgaacttgttgaa
aaagtactcctcgaagagcagataaaaattgtaaaagaatattatgttggtgttgttgtt
aatagaaacgaaaaaaacaatgttgttatattttcaacagaaggtggagtagatatcgaa
gaagtagcttcaaaaactcctgaaaaaataataaaattatcattaaaccctgaaaaagaa
tttttaccataccttgcaagaggcatgcttaaaaaagcaggcatcccaagtgcagaaatt
ccaaaagtagcagatgttttatgcaaagtttacaaagcattcaaaaacatggacggaatt
ttagcggaaataaacccactcgtatttactgaagatggaaaaatcattgctgctgatgca
gttttaaatgttgacgacgatgcatactttagacataactatgagaaatttgaagaattt
aataaacaggaaaaatccgaatttgcatatgttgaacttgatggagacattgcagttatt
ggaaacggtgcgggacttacccttgcaagcatggacattgtaaaagaatttggcggaaac
cctgcatgtttcttagatgttggtggcggttcaaatagggaaaccgtaaaaaaagcactt
ttaaaagcaacctcccgaaaaaacgttaaaggagcatttataaacattcttggcggaatt
acacggtgtgatgaagtttcgatgggaattgtagatgttttaaaagaaaatccaaatctt
aagtttgctgtcaggatgatgggaacgaacgaagaagaaggaagaagaatattatctgaa
aatggaataagcttcgaaagctcgatggaaggggctgcaaaagcacttactgaattaata
aatagttaa

DBGET integrated database retrieval system