KEGG   Methanococcus maripaludis S2: MMP1105Help
Entry
MMP1105           CDS       T00164                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase (ADP-forming), beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00020  Citrate cycle (TCA cycle)
mmp00640  Propanoate metabolism
mmp00660  C5-Branched dibasic acid metabolism
mmp00720  Carbon fixation pathways in prokaryotes
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
Module
mmp_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMP1105 (sucC)
   00640 Propanoate metabolism
    MMP1105 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MMP1105 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMP1105 (sucC)
Enzymes [BR:mmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MMP1105 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A DUF5461 HeH DUF5097
Motif
Other DBs
NCBI-ProteinID: CAF30661
UniProt: Q6LY86
Position
1096371..1097459
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENNIPIPKNKLVSGKVESIDYPVVIKAQVLVGGRGKAGGILFADNVD
DANEKIESLIGNTVKGELVEKVLLEEQIKIVKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLSLNPEKEFLPYLARGMLKKAGIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLVFTEDGKIIAADAVLNVDDDAYFRHNYEKFEEFNKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGNPACFLDVGGGSNRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSMGIVDVLKENPNLKFAVRMMGTNEEEGRRILSENGISFESSMEGAAKALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggaaatttttaaagaaaataatatcccgattcca
aaaaataaacttgtaagcggaaaggttgaaagcatcgactaccctgttgttataaaagcg
caagttttagttggcggaagaggtaaagctggcggaatcttatttgcagataatgtcgat
gatgcaaacgaaaaaattgaatcattaattggaaacacggttaaaggcgaacttgttgaa
aaagtactcctcgaagagcagataaaaattgtaaaagaatattatgttggtgttgttgtt
aatagaaacgaaaaaaacaatgttgttatattttcaacagaaggtggagtagatatcgaa
gaagtagcttcaaaaactcctgaaaaaataataaaattatcattaaaccctgaaaaagaa
tttttaccataccttgcaagaggcatgcttaaaaaagcaggcatcccaagtgcagaaatt
ccaaaagtagcagatgttttatgcaaagtttacaaagcattcaaaaacatggacggaatt
ttagcggaaataaacccactcgtatttactgaagatggaaaaatcattgctgctgatgca
gttttaaatgttgacgacgatgcatactttagacataactatgagaaatttgaagaattt
aataaacaggaaaaatccgaatttgcatatgttgaacttgatggagacattgcagttatt
ggaaacggtgcgggacttacccttgcaagcatggacattgtaaaagaatttggcggaaac
cctgcatgtttcttagatgttggtggcggttcaaatagggaaaccgtaaaaaaagcactt
ttaaaagcaacctcccgaaaaaacgttaaaggagcatttataaacattcttggcggaatt
acacggtgtgatgaagtttcgatgggaattgtagatgttttaaaagaaaatccaaatctt
aagtttgctgtcaggatgatgggaacgaacgaagaagaaggaagaagaatattatctgaa
aatggaataagcttcgaaagctcgatggaaggggctgcaaaagcacttactgaattaata
aatagttaa

DBGET integrated database retrieval system