KEGG   Methanococcus maripaludis S2: MMP1116Help
Entry
MMP1116           CDS       T00164                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1106057..1107109
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNIREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKYIDDKGFLKFTKIGGINDQMLLNQKVIVHGNNGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNREEAEKMGVEIGTAMSFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELLKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVSKADEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcgattatttaaagattctcgcaacagaaaaaggaatttctggtagagaa
gataacatacgagaatacatgaaaaaagaacttgaaaaatactgcgacagtattgaaaca
gataaatttggaaacttaattgcaaaaaaaggatctacaggtccaaaaatcatgattgca
tcacacatggacgaaatcgggctcatggttaaatatatagacgataaaggatttttaaaa
tttacaaaaattggcggaattaacgaccagatgctcttaaaccagaaagttatcgttcac
ggaaataacggcgatattgttggagttttaggatcaaaaccaccacacaaaatgaaagaa
agcgaaagaaacaaattaatttctgctgaacacatgtttatcgacatcggtgcaaaaaat
agggaagaagcagaaaaaatgggcgtagaaattggaactgcaatgtcatttaaatcagaa
tttgacaacctcggtggaaatgtagtttcatgtaaatcattcgacaacagggcaggctgt
gcagttgttttaaaaaccatggaattactcaaagatatggatttaaaatgccaggtttac
gctgttggaacagttcaggaagaagtaggacttaaaggtgcaaaaacatctgcatttgga
attaatcccgatgttgcattcgcacttgacgttacaatctgtggggatcatcctggaatt
aaattagaagatgcaccagttgaacttggaaaaggtcctgttgctacaattgttgatgca
tctggaagaggaattattacacacccaacagttttaagaatggtaagagatgtttcaaaa
gcagatgagatacctgttcaatacgaagttggagagggcggaactactgacgcaaccgca
attcacttaacaagagatggaattccaacaggagttatatctgttccttcaagatacatc
cacaccccagttgaagttattgatacagaagatcttgaaaaaacaaccgaactcgttgtt
gcatgcattaaaaaagtacatgaatacttttaa

DBGET integrated database retrieval system