KEGG   Methanococcus maripaludis S2: MMP1145Help
Entry
MMP1145           CDS       T00164                                 

Gene name
minD
Definition
(RefSeq) septum formation inhibitor-activating ATPase
  KO
K03609  
septum site-determining protein MinD
Organism
mmp  Methanococcus maripaludis S2
Brite
Chromosome [BR:mmp03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    MMP1145 (minD)
Cytoskeleton proteins [BR:mmp04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   MMP1145 (minD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134778..1135566
Genome map
AA seq 262 aa AA seqDB search
MIITVASGKGGVGKTTTSANLAVALSKLGKKTIVIDGDISMANLGLIFDFEKKRPSIHEV
LAEECSVRDAIYEHRTGTYVLPASLSIAGYKKSDLDLFPDVINEIADEYDYVIIDAPAGL
NKDMAIHLAIADKILLVVTPELFSIADAMKIKESSEMAGTNVMGIVLNRTGKDFGEMGPD
EIEMILEEKIVGLIPEDENIRNSTLKKMDVIEYNPRCPSSKAYTELALKVTGSYVDIGKI
EEIYNENFFEKLKRSIFSKFKK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattattacggtagcttctggaaaaggtggagttggaaaaacgacaacttctgcaaat
ttagctgttgcgctgtccaaactcggcaaaaaaactattgtaattgatggcgatatatca
atggccaatttagggttaatatttgattttgaaaaaaagaggccctccatccatgaagtt
ctcgcagaagagtgctctgtaagagatgcaatttacgaacaccgaactggaacttacgta
cttccagcaagcctttctattgcaggctacaaaaaatcagacctcgatttattccctgat
gtaataaatgaaattgctgatgaatacgattacgtaattattgatgctccagcaggtttg
aacaaagacatggcaattcaccttgcaattgcagataaaatcctacttgtggtaactcct
gaacttttttcaattgctgatgcgatgaaaattaaagaaagcagtgaaatggcaggcacc
aacgtaatgggaattgttttaaatagaactggaaaagatttcggtgaaatggggcctgat
gaaatagaaatgattttagaagaaaaaattgttggattgatccccgaagatgaaaatatt
cgaaattcaacccttaaaaaaatggatgtaatcgagtacaatcctcgatgcccttcttca
aaagcatatactgaacttgcactaaaagttactggttcatacgttgatattggaaaaatt
gaagaaatttacaatgaaaatttctttgaaaaattaaaaagaagcattttttcaaaattt
aagaaataa

DBGET integrated database retrieval system