KEGG   Methanococcus maripaludis S2: MMP1145Help
Entry
MMP1145           CDS       T00164                                 

Gene name
minD
Definition
septum formation inhibitor-activating ATPase
Orthology
K03609  
septum site-determining protein MinD
Organism
mmp  Methanococcus maripaludis S2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134778..1135566
Genome map
AA seq 262 aa AA seqDB search
MIITVASGKGGVGKTTTSANLAVALSKLGKKTIVIDGDISMANLGLIFDFEKKRPSIHEV
LAEECSVRDAIYEHRTGTYVLPASLSIAGYKKSDLDLFPDVINEIADEYDYVIIDAPAGL
NKDMAIHLAIADKILLVVTPELFSIADAMKIKESSEMAGTNVMGIVLNRTGKDFGEMGPD
EIEMILEEKIVGLIPEDENIRNSTLKKMDVIEYNPRCPSSKAYTELALKVTGSYVDIGKI
EEIYNENFFEKLKRSIFSKFKK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattattacggtagcttctggaaaaggtggagttggaaaaacgacaacttctgcaaat
ttagctgttgcgctgtccaaactcggcaaaaaaactattgtaattgatggcgatatatca
atggccaatttagggttaatatttgattttgaaaaaaagaggccctccatccatgaagtt
ctcgcagaagagtgctctgtaagagatgcaatttacgaacaccgaactggaacttacgta
cttccagcaagcctttctattgcaggctacaaaaaatcagacctcgatttattccctgat
gtaataaatgaaattgctgatgaatacgattacgtaattattgatgctccagcaggtttg
aacaaagacatggcaattcaccttgcaattgcagataaaatcctacttgtggtaactcct
gaacttttttcaattgctgatgcgatgaaaattaaagaaagcagtgaaatggcaggcacc
aacgtaatgggaattgttttaaatagaactggaaaagatttcggtgaaatggggcctgat
gaaatagaaatgattttagaagaaaaaattgttggattgatccccgaagatgaaaatatt
cgaaattcaacccttaaaaaaatggatgtaatcgagtacaatcctcgatgcccttcttca
aaagcatatactgaacttgcactaaaagttactggttcatacgttgatattggaaaaatt
gaagaaatttacaatgaaaatttctttgaaaaattaaaaagaagcattttttcaaaattt
aagaaataa

DBGET integrated database retrieval system