KEGG   Methanococcus maripaludis S2: MMP1187Help
Entry
MMP1187           CDS       T00164                                 

Gene name
fucA
Definition
class II aldolase/adducin family protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170696..1171238
Genome map
AA seq 180 aa AA seqDB search
MDLTEFIKICRLLYDRKYVVGSGGNVSIRDGNLIYITPTGLSLGFLTKEDICIADLNGNI
IKGKPTSELNMHLKIYQNKDSINAVVHTHSMYCTAFSALDKKLKLVTPEAEMVVKKIAYV
DYFPCGSLELAENVSECIEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatttaactgaatttataaaaatatgccgtttattatacgatcgaaaatacgtcgtt
ggttctgggggaaatgtaagtattcgggatggaaatttaatatatattacgccaacaggt
ttaagtttaggatttttaacaaaagaagatatctgcattgctgatttaaatggaaatatc
ataaaaggaaaacctacttcagaattaaacatgcatttaaaaatataccaaaataaagat
tcaataaatgctgtagttcacacacactcaatgtactgcaccgcattttccgcacttgat
aaaaaactaaaattagtaacccctgaagctgaaatggttgttaaaaaaatagcatacgtt
gactatttcccatgcggaagtttagaacttgcagaaaatgtttcagaatgcattgaagac
tcaattatcttaaaaaaccacggaattgttacattgggtaaagatataactgaagcatac
ataaaaaccgaagttttagaagaagttgcacagttaaattatattatgaacaatttaaaa
taa

DBGET integrated database retrieval system