KEGG   Methanococcus maripaludis S2: MMP1244Help
Entry
MMP1244           CDS       T00164                                 

Gene name
fwdH
Definition
(GenBank) tungsten containing formylmethanofuran dehydrogenase, subunit H
  KO
K00204  4Fe-4S ferredoxin
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00680  Methane metabolism
mmp01100  Metabolic pathways
mmp01120  Microbial metabolism in diverse environments
mmp01200  Carbon metabolism
Module
mmp_M00567  Methanogenesis, CO2 => methane
mmp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MMP1244 (fwdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_9 Fer4_21 Fer4_7 Fer4_2 Fer4_10 Fer4_15 Fer4_22 HTH_3 Fer4_19 HTH_19 Fer4_13 HTH_23 Fer4_17
Motif
Other DBs
NCBI-ProteinID: CAF30800
UniProt: Q6LXV2
Position
1228973..1229419
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGRYPSDKVMRVSEEIIS
LPKEHGIPLITSLGDNKQITKKLIERIYNITISIDMEKCIACGKCLECEYGAISVYSEDI
GISIDREKCILCCKCVSECPVGALKIVK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatatattatccgggatcaaagcagtagtcgcaataaatatgcgaaaagaa
gggaaacttcaaagagaaatagcagagtttctagaaatggatcgttcaatcatctcccat
tatttacacggcagatatccatcagataaggtcatgagagtctctgaagagattatatct
ttacccaaagaacacggcattccattaattacttcgcttggtgacaacaagcagattact
aaaaagttaatagaacggatatacaatataacaataagtattgacatggaaaagtgtatc
gcatgtggcaaatgccttgaatgcgaatacggggcaatttcggtatattccgaagacatc
ggcatatcaatagacagggaaaagtgtattctctgttgtaaatgcgtttccgaatgtcct
gttggtgctttgaaaatagtcaaataa

DBGET integrated database retrieval system