KEGG   Methanococcus maripaludis S2: MMP1258Help
Entry
MMP1258           CDS       T00164                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MMP1258 (hemB)
Enzymes [BR:mmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MMP1258 (hemB)
Exosome [BR:mmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMP1258 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1240981..1241949)
Genome map
AA seq 322 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETVLTKNDLIMPIFVDENLKNNEKTPITSMPGQFRYGVDSA
VKECVEISKLGVPGVILFGIPTEKDEFANSAVNENGGVQKVISKVKAELGDDLLVIADVC
MCEYTSHGHCGIIKGEEILNDETLEILGNIALSYAKAGVDIVAPSDMMDGRVLKIRNVLD
ENGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQMDMGNSREAIKEIELDIKE
GADLILVKPALPYLDIVKMAKKISNVPVGGYCVSGEYSMIEAAAEKGWLDREKVIYETLL
SIKRAGADFIITYWAKEVAKWL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaggccaagaagacttagaaaaaaccagaaaatcagggatttagtaagagaa
accgttttaaccaaaaacgatttaataatgccaattttcgtagatgaaaacttaaaaaac
aatgaaaaaactccaattacctcaatgccaggacagtttcggtacggggtagattccgca
gttaaagagtgcgtcgaaatttcaaaactcggggttccaggggtaattttgtttggaatt
ccaactgaaaaggatgaatttgcaaactctgcggtaaatgaaaacggtggagttcaaaag
gttatttcaaaagtaaaggccgaacttggagacgatcttttagtaattgcggatgtctgt
atgtgtgaatacacaagccacgggcactgcggcataattaaaggggaagaaattttaaac
gacgagacacttgaaatacttggaaatattgctctgtcatatgcaaaggccggtgttgat
attgttgcaccatctgacatgatggatggaagggttttaaaaattagaaatgttttggat
gagaatggatttaaaaacgtttcaataatgagttatgctgcaaaatatgcatcagcattt
tacgggccatttagggatgctgcagagagcacaccgcaatttggggatagaaaatcatac
cagatggatatgggaaactcaagagaagccataaaagagatagaactcgatataaaagaa
ggtgctgacttaattttggtaaaaccggctcttccgtatcttgatattgtaaaaatggca
aaaaaaatatctaatgttccagtcggaggatactgtgtaagtggggagtattcaatgatt
gaagcagcggctgaaaaaggatggcttgatagggaaaaagtaatatacgaaacgctttta
agcataaaaagggcaggtgctgactttataataacatactgggcaaaagaagttgctaag
tggctataa

DBGET integrated database retrieval system