KEGG   Methanococcus maripaludis S2: MMP1274Help
Entry
MMP1274           CDS       T00164                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mmp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258142..1259815)
Genome map
AA seq 557 aa AA seqDB search
MVSLLNKFVKKTEFESYEDFVENFKIDVPENFNFAYDIVDEYAKIAPEKIAIIWCDDNND
EKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGENGVPDYVDEAVSEINSDVLKACVSNLNNDSWIDFSK
ELEESSEDFTRPVGEMDTKNDDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIRGKLYGQWIAGTAVFVYDYDRFDAGNMLEKIAKYKITTFCAPP
TIYRFMIKQDISKADFSSLHYAVTAGEPLNPEVYNKFLEFTGLRLMEGFGQTETVVSVAN
FTWMDPKPGSMGKPVPIFDLMIKGPDGKECDVGEEGELAFKTEDGKPLGLFSGYFKDPER
TKKAWYDGYYHTGDTAWKDEDGYLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPVRGQIVKATIVLTSEYEASEELKKELQDHVKHNTAPYKYPRAIEFVKELPKTI
SGKIRRVEIRETDEKNK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtatcattacttaataaatttgttaaaaagacggaatttgagtcatatgaagatttt
gtggaaaatttcaagatagatgttccagaaaatttcaattttgcttacgatatcgttgac
gaatatgcaaaaattgcaccggaaaagattgcaattatatggtgtgacgataacaacgac
gaaaaaatctttacattcaaagatatgaaaaaatacagtgataaagcagctaatttcttt
ttaaaacacggaattaaaaagggagacactgtaatgctcacattaaagagcaggtacgaa
ttctggttctgcatgcttggacttcataaaattggggctgtcgcaattcctgcaacacac
atgcttacaacaaaagatatcgtgtacaggattgaaaaagcaggcttaaaaatgatagtc
tgtatcggagaaaacggagttcccgactacgttgatgaagcagtatctgaaattaattca
gatgttttaaaagcatgtgtttcaaatttaaacaatgatagttggattgatttttcaaaa
gaattggaagaatcatcagaagactttacaaggcctgttggagaaatggatactaaaaat
gacgatgtattagttgcatatttttcatcaggaacaacaggatatccaaaattaattcag
cacgaccacgaatatcctttaggacatattacgactgcaaaatactggcaaaatgttgaa
gacgatggacttcactacactgttgcagacagtggatgggcaaagtgtatccggggaaaa
ctctacggacagtggattgcaggaactgcagtatttgtctacgactacgacagatttgat
gcaggaaatatgcttgaaaaaattgcaaaatataaaattacaacgttctgcgcaccacct
acaatttacaggttcatgatcaaacaggatatttcaaaagcagacttttcaagtttacac
tacgcagtaactgctggagaaccgctaaaccctgaagtttacaacaaatttttggagttt
actgggcttagattaatggaaggatttggtcagaccgagaccgttgtatctgttgcaaac
tttacatggatggatccaaaacccggatcaatgggaaaaccagtgccaatttttgattta
atgataaaagggccagatggaaaagaatgcgatgtgggtgaagaaggagaacttgcattc
aaaacagaagatggaaaacctcttggtcttttctcaggatactttaaagaccctgaaaga
actaaaaaagcctggtacgatggatattaccatactggggatactgcatggaaagatgaa
gatggatacctctggtttgttggaagaaacgacgatttaatcaaaagttccggttacaga
atcggtcctttcgaagtagaaagtgcacttatttcacaccctgcagtacttgaatgtgca
ataactggagtaccggacccagtaaggggccagattgttaaagctacaattgttttaacg
tctgaatatgaagcaagtgaggaacttaaaaaagaacttcaagaccacgttaaacacaac
actgccccatacaaataccctcgagctattgaatttgtaaaagaactcccaaaaacaatc
agcgggaaaatcaggcgtgtagaaatccgggaaactgatgaaaaaaataaataa

DBGET integrated database retrieval system