KEGG   Methanococcus maripaludis S2: MMP1274Help
Entry
MMP1274           CDS       T00164                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP1274
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP1274
   00620 Pyruvate metabolism
    MMP1274
   00640 Propanoate metabolism
    MMP1274
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMP1274
   00680 Methane metabolism
    MMP1274
Enzymes [BR:mmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MMP1274
Lipid biosynthesis proteins [BR:mmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MMP1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258142..1259815)
Genome map
AA seq 557 aa AA seqDB search
MVSLLNKFVKKTEFESYEDFVENFKIDVPENFNFAYDIVDEYAKIAPEKIAIIWCDDNND
EKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGENGVPDYVDEAVSEINSDVLKACVSNLNNDSWIDFSK
ELEESSEDFTRPVGEMDTKNDDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIRGKLYGQWIAGTAVFVYDYDRFDAGNMLEKIAKYKITTFCAPP
TIYRFMIKQDISKADFSSLHYAVTAGEPLNPEVYNKFLEFTGLRLMEGFGQTETVVSVAN
FTWMDPKPGSMGKPVPIFDLMIKGPDGKECDVGEEGELAFKTEDGKPLGLFSGYFKDPER
TKKAWYDGYYHTGDTAWKDEDGYLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPVRGQIVKATIVLTSEYEASEELKKELQDHVKHNTAPYKYPRAIEFVKELPKTI
SGKIRRVEIRETDEKNK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtatcattacttaataaatttgttaaaaagacggaatttgagtcatatgaagatttt
gtggaaaatttcaagatagatgttccagaaaatttcaattttgcttacgatatcgttgac
gaatatgcaaaaattgcaccggaaaagattgcaattatatggtgtgacgataacaacgac
gaaaaaatctttacattcaaagatatgaaaaaatacagtgataaagcagctaatttcttt
ttaaaacacggaattaaaaagggagacactgtaatgctcacattaaagagcaggtacgaa
ttctggttctgcatgcttggacttcataaaattggggctgtcgcaattcctgcaacacac
atgcttacaacaaaagatatcgtgtacaggattgaaaaagcaggcttaaaaatgatagtc
tgtatcggagaaaacggagttcccgactacgttgatgaagcagtatctgaaattaattca
gatgttttaaaagcatgtgtttcaaatttaaacaatgatagttggattgatttttcaaaa
gaattggaagaatcatcagaagactttacaaggcctgttggagaaatggatactaaaaat
gacgatgtattagttgcatatttttcatcaggaacaacaggatatccaaaattaattcag
cacgaccacgaatatcctttaggacatattacgactgcaaaatactggcaaaatgttgaa
gacgatggacttcactacactgttgcagacagtggatgggcaaagtgtatccggggaaaa
ctctacggacagtggattgcaggaactgcagtatttgtctacgactacgacagatttgat
gcaggaaatatgcttgaaaaaattgcaaaatataaaattacaacgttctgcgcaccacct
acaatttacaggttcatgatcaaacaggatatttcaaaagcagacttttcaagtttacac
tacgcagtaactgctggagaaccgctaaaccctgaagtttacaacaaatttttggagttt
actgggcttagattaatggaaggatttggtcagaccgagaccgttgtatctgttgcaaac
tttacatggatggatccaaaacccggatcaatgggaaaaccagtgccaatttttgattta
atgataaaagggccagatggaaaagaatgcgatgtgggtgaagaaggagaacttgcattc
aaaacagaagatggaaaacctcttggtcttttctcaggatactttaaagaccctgaaaga
actaaaaaagcctggtacgatggatattaccatactggggatactgcatggaaagatgaa
gatggatacctctggtttgttggaagaaacgacgatttaatcaaaagttccggttacaga
atcggtcctttcgaagtagaaagtgcacttatttcacaccctgcagtacttgaatgtgca
ataactggagtaccggacccagtaaggggccagattgttaaagctacaattgttttaacg
tctgaatatgaagcaagtgaggaacttaaaaaagaacttcaagaccacgttaaacacaac
actgccccatacaaataccctcgagctattgaatttgtaaaagaactcccaaaaacaatc
agcgggaaaatcaggcgtgtagaaatccgggaaactgatgaaaaaaataaataa

DBGET integrated database retrieval system