KEGG   Methanococcus maripaludis S2: MMP1398Help
Entry
MMP1398           CDS       T00164                                 

Gene name
dapE
Definition
diaminopimelate aminotransferase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mmp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1381339..1382586
Genome map
AA seq 415 aa AA seqDB search
MKSILDETIELSSDLISINSVNPTFGGIGEKEKSIYIKNKLEEYNKNYSIKNCEITEYNT
VDSEGIERPNIVSKYDFGKNDTLTIISHMDIVPEGDLGLWNSDPFKAEIKDGIIYGRGSE
DNHKGIVSSFLLLKMIFEEKIDPKYNLNLIFVADEEDGSKYGLSYLVNNFEDEIFSSKDL
IIVPDFGMPEGEFIEIAEKNILWLKFKITGKQCHGSVPENGINADLIAFSFGKGLYDKLY
GKYDGINPIFNPAFSTFEPTILKNNIENINTIPGYVELNFDCRIIPKYDPKEVLSDIENY
IEVFKNEIEKHILHFDISEKENISITYEILKLEKAEETKKDSEVVKKLGSAIKNVLNKES
VLCGMGGGTVAAFLREKGYNTAVWGIGDETAHQPNEHIKIENLIKMAEVYLDILK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattttggatgaaactattgaactttcttctgatctaatatctataaactca
gtaaatccaacttttggcggaattggggaaaaagaaaagtcaatttacataaaaaataag
ctagaagaatataataaaaattattcaataaaaaattgcgaaataaccgaatacaatacc
gttgattcagaaggaattgaaaggccaaatatcgtttcaaaatacgattttggaaaaaat
gatacccttacaataatttcacacatggatatagttcctgaaggggaccttggcctctgg
aactccgacccatttaaagctgaaataaaagacgggataatttatggtaggggcagtgaa
gacaaccataaaggaatagtttcatcgtttttgcttttaaagatgatttttgaagaaaaa
atcgatccaaaatataatctaaatctaatttttgtagctgacgaagaagacggcagtaaa
tacggtctttcttaccttgtaaataactttgaagatgaaatttttagctcaaaagatttg
ataattgttccagattttggaatgcccgaaggagaatttatcgaaattgctgaaaaaaac
atactgtggctaaaatttaaaattacaggaaaacagtgccatggaagtgttcctgaaaat
ggaataaacgcagatttaatcgcattttcatttggaaaaggactttacgataaactctac
ggtaaatatgatggcataaatccaatattcaaccccgcattttcaacttttgaacctaca
attttgaaaaataacattgaaaacataaatacaattcccggatacgttgaattaaacttt
gactgcagaattattccaaaatacgatccaaaagaagtactaagcgatattgaaaattat
attgaagtttttaaaaatgaaattgaaaaacatattctccattttgatatttctgaaaaa
gaaaatatttcgataacttacgagattttaaaacttgaaaaagcagaagaaacaaaaaaa
gattcagaagttgttaaaaaactgggttctgcaattaaaaacgtgttaaataaagaatca
gtattatgcggaatgggtggtggaaccgttgccgcatttttaagagaaaaaggatacaac
actgcagtttggggaattggagacgaaactgcacaccagccaaatgaacatataaaaata
gaaaatttaataaaaatggcagaagtgtatcttgatatattaaaataa

DBGET integrated database retrieval system