KEGG   Methanococcus maripaludis S2: MMP1505Help
Entry
MMP1505           CDS       T00164                                 

Gene name
porA
Definition
(GenBank) pyruvate oxidoreductase (synthase) subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp00020  Citrate cycle (TCA cycle)
mmp00620  Pyruvate metabolism
mmp00633  Nitrotoluene degradation
mmp00640  Propanoate metabolism
mmp00650  Butanoate metabolism
mmp00680  Methane metabolism
mmp00720  Carbon fixation pathways in prokaryotes
mmp01100  Metabolic pathways
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
Module
mmp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmp_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP1505 (porA)
   00020 Citrate cycle (TCA cycle)
    MMP1505 (porA)
   00620 Pyruvate metabolism
    MMP1505 (porA)
   00640 Propanoate metabolism
    MMP1505 (porA)
   00650 Butanoate metabolism
    MMP1505 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMP1505 (porA)
   00680 Methane metabolism
    MMP1505 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MMP1505 (porA)
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MMP1505 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: CAF31061
UniProt: Q6LX47
Position
complement(1464410..1465573)
Genome map
AA seq 387 aa AA seqDB search
MCEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVANGELNAEYIKVESEH
SAMSASIGASAAGARAFTATSSQGLALMHEVLFSAAGMRVPVVMMNANRALSAPINIWND
QQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPVMVNLDGFILTHTVEPVT
VPKQENVLDFIGTYEPKHAYLDPKKPMTQGALGDPNYYMETRYAIETAMRNAEKVIADVH
DAFAEKFNRAYGNGLIESYNLEKAENVIIAMGSICGTIKDIIDLKKKEGVEIGLLKIRCY
RPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVASHLKDKKTVNYIVGLGGRDIT
PEDILGIYDDVEISEDGKTNWIGLKEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagttaaggttatcacaggaacttctgcagccgctgaagctgcaaagcttgca
gatgtagatgttattgcagcatatccaattaccccccaaacgacatgtgtagaaaagctt
gcagattttgtggctaatggtgaattaaacgcagaatacattaaagtagaaagtgaacat
tctgcaatgagtgcaagtattggagcaagtgcggcaggtgcaagagcatttactgcaaca
tcatcacaaggtttagcattgatgcacgaagttttattttcagcagcaggaatgagagtt
ccagttgtaatgatgaatgcaaacagggcattatctgcaccaattaacatttggaatgac
cagcaagacagtttatctcaaagagatacaggatggattcaactatatgctgaagacaac
caggaagttttagatttagttattcaagcatttaaaattgcagaagacgaaaaagttctt
cttccagttatggtaaacttagatggttttattttaacacatactgtagaaccagttaca
gttccaaaacaagaaaatgtactcgattttatcggaacttatgaaccaaaacatgcgtac
ttggaccctaaaaaaccaatgacacaaggtgctcttggtgatccaaattactacatggaa
acaagatatgcaattgaaaccgcaatgagaaacgctgaaaaagttattgcagacgttcac
gatgcttttgcagaaaaattcaacagagcttacggaaacgggcttattgaaagttacaat
ttagaaaaagcagaaaacgtaattattgcaatgggttcaatttgtggaacaattaaagat
attattgatctcaagaaaaaagaaggcgtagaaatcggtttattaaaaataagatgctac
agaccacttcctgttgaaatgatcaaagatgcactcaaaaatgctaaaaatgttgcaatt
cttgataagagcataagccttggcatgaacaaaggtgcaatttatgcagatgttgcatca
catttgaaagataaaaagactgtaaattacatcgtaggtcttggtggacgagatattact
ccagaagacattttgggaatttacgacgatgtagaaatttctgaagatggaaaaacaaac
tggatcggattgaaggaagaataa

DBGET integrated database retrieval system