KEGG   Methanococcus maripaludis S2: MMP1506Help
Entry
MMP1506           CDS       T00164                                 

Gene name
porD
Definition
pyruvate oxidoreductase (synthase) subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMP1506 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP1506 (porD)
   00020 Citrate cycle (TCA cycle)
    MMP1506 (porD)
   00620 Pyruvate metabolism
    MMP1506 (porD)
   00640 Propanoate metabolism
    MMP1506 (porD)
   00650 Butanoate metabolism
    MMP1506 (porD)
  Energy metabolism
   00680 Methane metabolism
    MMP1506 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MMP1506 (porD)
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MMP1506 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1465595..1465852)
Genome map
AA seq 85 aa AA seqDB search
MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQDKCVKCENCYIFCPEGCIQEKDGKFEIDY
DYCKGCLICEKECPVKAIKAEREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacacaggaacaattatttatgaacctggaagttcagcaaacaataaaactgga
agctggagagtattcaaaccagttttagatcaagacaaatgcgtaaaatgcgaaaattgt
tacatcttctgtcctgaaggctgtatccaagaaaaagatggaaaatttgaaattgactac
gactactgtaaaggatgcctaatttgcgagaaagaatgtcctgtaaaagcgataaaagca
gaaagggaagaaaaataa

DBGET integrated database retrieval system