KEGG   Methanococcus maripaludis S2: MMP1567Help
Entry
MMP1567           CDS       T00164                                 

Gene name
mtrH
Definition
(GenBank) N5-methyltetrahydromethanopterin: methyltransferase, subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00680  Methane metabolism
mmp01100  Metabolic pathways
mmp01120  Microbial metabolism in diverse environments
mmp01200  Carbon metabolism
Module
mmp_M00357  Methanogenesis, acetate => methane
mmp_M00567  Methanogenesis, CO2 => methane
mmp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MMP1567 (mtrH)
Enzymes [BR:mmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MMP1567 (mtrH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: CAF31123
UniProt: Q6LWY7
Position
1519462..1520421
Genome map
AA seq 319 aa AA seqDB search
MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYSRHKIVEDAKKGIFDKKAAEALINK
QAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDSTSGKARMAAANRATEAG
YANQCIYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVAGKLNVLNDGGKTKDIGM
LELAEKAGIKYPLIDVAVTPMGNGAGHAVRAAFAVKAKLGLPVGSGIHNVPSAWDWLREF
RKGLREEGKDQIAKDVHHVCDIGANIVQTMTSGDYVLYGPIDNAELAFPAVAMTDMIIAE
TAKEMGTVPVAEHPLNKLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatttgacaaagaacaaatggtcattgagttcgctggtgcaaaattcggtgga
caaccaggagaatacccaaccgcattatccggtacaattttctattcaagacacaaaatt
gtagaagatgctaaaaaaggtatcttcgataaaaaagctgctgaagctttaatcaacaaa
caagctgaaatgcaagacattacaggaaactcagcattcgtgcaagttttcggtggtact
gaagaagctttagttaactacattgattttgtttccgaagtatgggacggtccaatgtta
ctcgactcaacatccggtaaagcaagaatggctgctgcaaacagagctacagaagcagga
tacgcaaaccagtgtatctacaactcaatcaacgttgctgcagaagacgaagaaattgaa
aacttaacaaacagtgatgttgaagcttcaatcgttttatgtttcgacccaatggatcca
tccgttgcaggtaaattaaacgtattaaacgatggtggtaaaacaaaagacatcggtatg
ttagaacttgcagaaaaagcaggtattaaatacccactcatcgacgttgcagtaacccca
atgggtaacggtgcaggtcacgctgttagagctgcttttgcagttaaagcaaaactcggt
ttacctgtaggtagcggtattcacaacgtaccttccgcatgggactggcttagggaattc
agaaaaggattaagagaagaaggaaaagatcagatcgcaaaagacgtacaccacgtatgt
gacatcggtgcaaacattgtacagacaatgacatcaggtgactacgttttatacggtcca
atcgacaatgctgaacttgcattccctgcagttgcaatgaccgatatgatcatcgcagaa
acagcaaaagaaatgggaacagtgcctgttgcagaacacccactaaacaaattaatttaa

DBGET integrated database retrieval system