KEGG   Methanococcus maripaludis S2: MMP1567Help
Entry
MMP1567           CDS       T00164                                 

Gene name
mtrH
Definition
tetrahydromethanopterin S-methyltransferase subunit H (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mmp01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519462..1520421
Genome map
AA seq 319 aa AA seqDB search
MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYSRHKIVEDAKKGIFDKKAAEALINK
QAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDSTSGKARMAAANRATEAG
YANQCIYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVAGKLNVLNDGGKTKDIGM
LELAEKAGIKYPLIDVAVTPMGNGAGHAVRAAFAVKAKLGLPVGSGIHNVPSAWDWLREF
RKGLREEGKDQIAKDVHHVCDIGANIVQTMTSGDYVLYGPIDNAELAFPAVAMTDMIIAE
TAKEMGTVPVAEHPLNKLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatttgacaaagaacaaatggtcattgagttcgctggtgcaaaattcggtgga
caaccaggagaatacccaaccgcattatccggtacaattttctattcaagacacaaaatt
gtagaagatgctaaaaaaggtatcttcgataaaaaagctgctgaagctttaatcaacaaa
caagctgaaatgcaagacattacaggaaactcagcattcgtgcaagttttcggtggtact
gaagaagctttagttaactacattgattttgtttccgaagtatgggacggtccaatgtta
ctcgactcaacatccggtaaagcaagaatggctgctgcaaacagagctacagaagcagga
tacgcaaaccagtgtatctacaactcaatcaacgttgctgcagaagacgaagaaattgaa
aacttaacaaacagtgatgttgaagcttcaatcgttttatgtttcgacccaatggatcca
tccgttgcaggtaaattaaacgtattaaacgatggtggtaaaacaaaagacatcggtatg
ttagaacttgcagaaaaagcaggtattaaatacccactcatcgacgttgcagtaacccca
atgggtaacggtgcaggtcacgctgttagagctgcttttgcagttaaagcaaaactcggt
ttacctgtaggtagcggtattcacaacgtaccttccgcatgggactggcttagggaattc
agaaaaggattaagagaagaaggaaaagatcagatcgcaaaagacgtacaccacgtatgt
gacatcggtgcaaacattgtacagacaatgacatcaggtgactacgttttatacggtcca
atcgacaatgctgaacttgcattccctgcagttgcaatgaccgatatgatcatcgcagaa
acagcaaaagaaatgggaacagtgcctgttgcagaacacccactaaacaaattaatttaa

DBGET integrated database retrieval system