KEGG   Methanococcus maripaludis S2: MMP1577Help
Entry
MMP1577           CDS       T00164                                 

Gene name
hat
Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmp  Methanococcus maripaludis S2
Brite
Enzymes [BR:mmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MMP1577 (hat)
Transfer RNA biogenesis [BR:mmp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MMP1577 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526282..1527904)
Genome map
AA seq 540 aa AA seqDB search
MSDYSEFIRCIISNLLVEKEKIKDLDPKRKKQKVEDIKARCLRKFDLNVGFPPNSDIISQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERISQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CLDAMNGEVSETLEKAQEKNETAKHRCVALTLETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGTDASIKATQLLKDSGLKVSYHLIPGLPKTTPEMDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFNPMTDEQAVEVITYGKSIMPKWIRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEEKGIKCKCIRCREVGHVTYKKGIKPDLESIKLCRED
YESSGGKEIFLSFEDTKNDLLIGYLRLRIPNNPFRKEITDKSALIRQVHVCGQQKELEGS
SKELSWQHKGYGRLLIDEAEKIAREFNKDQVLINSGIGVREYYKKLGYKRVGPYMGKILK
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgactattcagaatttatacgttgtatcatttctaatcttttagttgaaaaggaa
aaaataaaagatctggacccaaagaggaaaaaacaaaaagtagaggatatcaaggcgcga
tgtcttcgtaaatttgatttaaacgtgggatttcctccaaattcagatattatcagtcag
gcttcagaagaggaaaaaaaggaattattgccacttttaagaaaaaaaccaataagaaca
ctttcaggagttgctgttgttgcagtaatgacttctccagaaccatgccctcatgggaaa
tgttcattctgcccgggtggaaaagaaagtaattttggcgatgttccacaaagttatact
ggaaaagaacctgcaacaatgcgtggagtaatgtataactttgatccatatgttcagaca
agtgaaaggatttcacaacttgaaaaagtgggccacccaacagataaggtagaactgata
ataatgggcggaacttttccggcaagagacattgaatatcaggaaaacttcataaaaaga
tgtcttgatgcgatgaatggtgaagtttcagaaacacttgaaaaagcacaggaaaaaaac
gaaactgcaaagcacaggtgtgtggcccttacccttgaaacaaggcctgattactgtaat
gaaaaagaaataaatgaaatgttaaaattgggaacaacaagagttgaacttggaattcaa
agtacaaacgatgaagttttggagtttgtaaaaagaggacacggaacagatgcatcaatc
aaagcaacccagcttttaaaagatagcggattgaaagtttcataccacttaattcccgga
cttccaaaaacaactccagaaatggataaagaaacaattaaaacagtatttgaaaatcca
aacttcaaaccagatttaattaaattttacccgtgcctcgtaattcccggaacagaagtc
tatgaattgtggcagagtggggaatttaatccaatgactgatgaacaggcagtagaagtt
attacttacggaaaatcgataatgccaaaatggatcaggacgtcaagaattcaaagagat
attcctgtaaccgtaattgacgcaggcgttaagaaaagtaaccttggagaactcgtttac
aataatttggaagaaaaaggaataaaatgtaaatgtatacgatgcagggaagttggacac
gttacatacaaaaaaggaataaagccagatttagaaagtattaaattatgcagggaagat
tacgaatcaagtggcggaaaagagatattcttatcgtttgaagatactaaaaacgatctt
ttgataggttatttaagacttaggattccaaataatccatttagaaaagaaataactgat
aaatctgcacttataagacaggttcatgtttgcggacagcagaaagaacttgaaggtagc
tcaaaagaactttcgtggcagcacaaaggctacggcagacttttaattgacgaagctgag
aaaatcgcaagagagttcaataaagatcaagtattaatcaatagcgggataggtgttcga
gaatactataaaaaacttggatacaaaagagtcggtccgtatatgggtaaaattcttaaa
taa

DBGET integrated database retrieval system