KEGG   Methanococcus maripaludis S2: MMP1585Help
Entry
MMP1585           CDS       T00164                                 

Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmp  Methanococcus maripaludis S2
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MMP1585
Enzymes [BR:mmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MMP1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534843..1535691
Genome map
AA seq 282 aa AA seqDB search
MYFEDYSKFLTAYDTFNDADFVIFGIPFDATTSYKPGARFGPDEVRNASWGLETFSPILK
KDLIDVKICDKYNLLMEGNQSEIINRAYSASKDILEAKKIPVMIGGEHSVTYPVVKAVKS
VYDDFAVIHFDAHCDLREEYMGNEQSHASVIRRTYDLTKDIFQFGIRSGDQDEWEFGWEN
TNISMEMPTKDDIKKIKELEKPIYVTIDIDVLDPAFVPGTGTPEPCGFTPKELINSLYLL
EEIKEKIVGFDVVEVSPHYDIGKITSVTAAKIIRELILTISK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgaagattattccaagtttctcacagcttatgatacatttaacgatgctgat
tttgttatttttggaattccttttgatgctacaacttcatacaaaccaggcgcgagattt
gggcctgatgaagttagaaacgcttcatggggacttgaaacatttagcccaattttaaaa
aaagatttaatcgatgtaaaaatttgcgacaaatacaaccttttaatggaaggaaaccag
tctgaaattataaatcgggcatatagtgcttcaaaagatattttagaagctaaaaaaata
ccggtaatgattggtggagaacactctgtaacataccctgttgtaaaagctgtaaaatcg
gtttatgatgactttgcagtaattcacttcgatgcacactgcgatttaagggaagaatat
atgggaaacgaacagtcccatgcaagtgtaattagaagaacttacgatttaacaaaagat
atcttccagtttggaatcagaagtggcgaccaagatgaatgggaatttggatgggaaaac
accaatatttcaatggaaatgcccacaaaagacgatatcaaaaagataaaagaacttgaa
aaaccaatttacgtaacaattgacattgatgtacttgaccctgcatttgtacctggaact
ggaactccagaaccctgcggatttacaccaaaagaacttataaactcactttatcttttg
gaagaaattaaagaaaaaattgttggttttgacgtggttgaagtttcaccacattacgac
atcggcaagattacatctgttaccgcagcaaaaatcattcgtgaattgatacttaccata
agcaaataa

DBGET integrated database retrieval system